DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Gm10334

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:247 Identity:81/247 - (32%)
Similarity:135/247 - (54%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVG 605
            :.:||||.:......|:|||:.       |..|.|||:|||:.|:.:|.||..    ::|::|:|
Mouse    21 DDKIVGGYTCQENSVPYQVSLN-------SGYHFCGGSLINDQWVVSAAHCYK----TRIQVRLG 74

  Fly   606 EYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLIG 670
            |::.:.::....::  ..||.:.||.::..|...|:.|:||..|:.....|:.:.|| :.....|
Mouse    75 EHNINVLEGNEQFV--NAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALP-SSCAPAG 136

  Fly   671 MNATVTGWGR-LSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSC 734
            ....::|||. ||.|.:.|.:||.:..|::...:|::.:  .|:   |....:|||:..||:|||
Mouse   137 TQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASY--PGK---ITGNMVCAGFLEGGKDSC 196

  Fly   735 QGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            |||||||:....:     |.||:|||.|||..:.|||.|::..:..||.:.:
Mouse   197 QGDSGGPVVCNGE-----LQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 79/239 (33%)
Tryp_SPc 544..785 CDD:238113 81/241 (34%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.