DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and RPS6KA5

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_004746.2 Gene:RPS6KA5 / 9252 HGNCID:10434 Length:802 Species:Homo sapiens


Alignment Length:352 Identity:161/352 - (45%)
Similarity:217/352 - (61%) Gaps:24/352 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 TCNSSG-VKKVTLENFEFLKVLGKGTFGKVILCREKA---TAKLYAIKILKKEVIIQKDEVA-HT 311
            |.|.:| .:||.:||||.|||||.|.:|||.|.|:.:   |.||||:|:|||..|:||.:.. ||
Human    34 TANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHT 98

  Fly   312 LTESRVLKSTNH-PFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIIS 375
            .||.:||:.... |||::|.|:|||..:|..::.|:||||||.|||....|||...:.|..||:.
Human    99 RTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVL 163

  Fly   376 ALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTK--TFCGTPEYLAPEVLDD 438
            ||.:||..||||||:||||:|||.:||:.:.||||.||.:. ..|.:  :||||.||:||:::..
Human   164 ALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVA-DETERAYSFCGTIEYMAPDIVRG 227

  Fly   439 NDYG--QAVDWWGTGVVMYEMICGRLPF----YNRDHDVLFTLILVEEVKFPRNITDEAKNLLAG 497
            .|.|  :|||||..||:|||::.|..||    .......:...||..|..:|:.::..||:|:..
Human   228 GDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQR 292

  Fly   498 LLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESV 562
            ||.||||||||.|..|..||:.|.||..|||.||..||:|.||||.:..:.|...|.:|||    
Human   293 LLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFT---- 353

  Fly   563 ELTPPDPTGPLGSI--AEEPLFPQFSY 587
            |:   |||....::  :.|.||..:|:
Human   354 EM---DPTYSPAALPQSSEKLFQGYSF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 127/269 (47%)
STKc_PKB 270..590 CDD:270723 151/333 (45%)
RPS6KA5NP_004746.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
STKc_MSK1_N 48..337 CDD:270764 140/289 (48%)
S_TK_X 320..379 CDD:214529 25/65 (38%)
STKc_MSK1_C 418..727 CDD:271081
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.