DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and AT5G40030

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_198819.1 Gene:AT5G40030 / 834000 AraportID:AT5G40030 Length:499 Species:Arabidopsis thaliana


Alignment Length:373 Identity:115/373 - (30%)
Similarity:186/373 - (49%) Gaps:84/373 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHT 311
            ::|...|:.:  :.:.|.:|..||.||.|..|.|.|...:.....:|:|::.|.::|.:.::...
plant    97 AIQNVKCSKN--EDLGLGHFRLLKKLGCGDIGSVYLAELREMGCFFAMKVMDKGMLIGRKKLVRA 159

  Fly   312 LTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHE----RIFTEDRTRFYGAE 372
            .||..:|...:||||.:|...|:|....|.:|::.:||:|  |:..:    :.|:|...|||.:|
plant   160 QTEREILGLLDHPFLPTLYSHFETEKFSCLLMEFCSGGDL--HILRQKQPGKHFSELAARFYASE 222

  Fly   373 IISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGL--------------------------- 410
            ::.||.|||..|::|||||.||:::.:||||.::||.|                           
plant   223 VLLALEYLHMMGVVYRDLKPENVMVREDGHIMLSDFDLSLQSFVSPTLIQSTSQPSCHIASYCIQ 287

  Fly   411 -------CKEDIT-----------------YGRTTK-------------------TFCGTPEYLA 432
                   ||..:.                 ..:|.|                   :|.||.||||
plant   288 PPCIDPSCKLPVACIQPSCFKPRFLNNKPRKAKTEKAGSDSLPMLIAEPTAARSMSFVGTHEYLA 352

  Fly   433 PEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFY-NRDHDVLFTLILVEEVKFPR-NITDEAKNLL 495
            ||::..:.:|.:||||..|:.:||::.|:.||. |.:.:.||. ::.:.:|||. :|:..||:|:
plant   353 PEIIRGDGHGSSVDWWTFGIFLYELLTGKTPFKGNGNRETLFN-VVGQPLKFPEGSISFAAKDLI 416

  Fly   496 AGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQ 543
            .|||.||||||| |.|....||:.||||.::||.  :::...||..|:
plant   417 RGLLTKDPKKRL-GFKKGATEIKQHPFFNNVNWA--LIRSTTPPEIPK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 105/332 (32%)
STKc_PKB 270..590 CDD:270723 110/350 (31%)
AT5G40030NP_198819.1 STKc_phototropin_like 113..464 CDD:270726 112/355 (32%)
Keratin_B2_2 276..>309 CDD:372783 2/32 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.