DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and PK1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001326081.1 Gene:PK1 / 820020 AraportID:AT3G08730 Length:465 Species:Arabidopsis thaliana


Alignment Length:371 Identity:145/371 - (39%)
Similarity:227/371 - (61%) Gaps:21/371 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 DELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQ 304
            |:...:.:::|.....|||  |.:::||.:||:|||.||||...|:|.|:::||:|:::|:.|::
plant   110 DDSDNEKALEGDLVKVSGV--VGIDDFEVMKVVGKGAFGKVYQVRKKETSEIYAMKVMRKDHIME 172

  Fly   305 KDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFY 369
            |:...:...|..:|...:|||::.|||||||..||..|:.::|||.||:.|.|:.:|.||..|.|
plant   173 KNHAEYMKAERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVY 237

  Fly   370 GAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTK--TFCGTPEYLA 432
            .|||:||:.:||.:||::||||.||:|:|.|||:.:.||||.||   :...|:  :.|||.||:|
plant   238 TAEIVSAVSHLHEKGIMHRDLKPENILMDTDGHVMLTDFGLAKE---FEENTRSNSMCGTTEYMA 299

  Fly   433 PEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAG 497
            ||::....:.:|.|||..|:::|||:.|:.||......:. ..|:.:::|.|:.:::||..:|.|
plant   300 PEIVRGKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQ-QKIVKDKIKLPQFLSNEAHAILKG 363

  Fly   498 LLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESV 562
            ||.|:|::|||.|....:||:.|.:|..|||..|..:::.|.|||:|:.......|||.:|..||
plant   364 LLQKEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCIANFDKCWTDMSV 428

  Fly   563 ELTPPDPTGPLGSIAEEPL---FPQFSYQGDMASTLGTSSHISTST 605
                  ...|..|.:.:|.   |..|:|.....|.|    |.||:|
plant   429 ------LDSPASSPSSDPKANPFTNFTYVRPPPSFL----HQSTTT 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 111/258 (43%)
STKc_PKB 270..590 CDD:270723 131/324 (40%)
PK1NP_001326081.1 STKc_AGC 140..389 CDD:270693 107/252 (42%)
S_TK_X 390..452 CDD:214529 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.