DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and S6K2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:405 Identity:151/405 - (37%)
Similarity:241/405 - (59%) Gaps:24/405 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDEL---SEQFSVQGTTCNSSGVKKVT----LENF 266
            |.|..:.:.::.:..:|.:    ||:....|.|.   :::||....|.:....::|:    :|:|
plant    80 VVSHSLKMNKLTLRETEDS----VDLVECVEGESIKENDEFSGNDDTDSEKSPEEVSGVVGIEDF 140

  Fly   267 EFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKY 331
            |.|||:|:|.||||...|:|.|:::||:|:::|:.|::|:...:...|..:|...:|||::.|||
plant   141 EVLKVVGQGAFGKVYQVRKKDTSEIYAMKVMRKDKIVEKNHAEYMKAERDILTKIDHPFIVQLKY 205

  Fly   332 SFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLL 396
            ||||..||..|:.::|||.||:.|.|:.:|.||..|.|.|||:||:.:||.:||::||||.||:|
plant   206 SFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMHRDLKPENIL 270

  Fly   397 LDKDGHIKVADFGLCKEDITYGRTTK--TFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMIC 459
            :|.|||:.:.||||.||   :...|:  :.|||.||:|||::....:.:|.|||..|:::|||:.
plant   271 MDVDGHVMLTDFGLAKE---FEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGILLYEMLT 332

  Fly   460 GRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFA 524
            |:.||......:. ..|:.:::|.|:.:::||..||.|||.|:|::|||.|....:||:.|.:|.
plant   333 GKPPFLGSKGKIQ-QKIVKDKIKLPQFLSNEAHALLKGLLQKEPERRLGSGPSGAEEIKKHKWFK 396

  Fly   525 SINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQG 589
            :|||..|..:::.|.|||.|:.......|||.:|..||..:|  .:.|.......| |..|:|..
plant   397 AINWKKLEAREVQPSFKPAVSGRQCIANFDKCWTDMSVLDSP--ASSPNSDAKANP-FTNFTYVR 458

  Fly   590 DMASTLGTSSHISTS 604
            ...|.|    |.:||
plant   459 PPHSFL----HRTTS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 2/4 (50%)
PH 107..211 CDD:278594 1/1 (100%)
S_TKc 266..523 CDD:214567 112/258 (43%)
STKc_PKB 270..590 CDD:270723 131/321 (41%)
S6K2NP_001327294.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.