DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and PID2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_180238.2 Gene:PID2 / 817211 AraportID:AT2G26700 Length:525 Species:Arabidopsis thaliana


Alignment Length:415 Identity:121/415 - (29%)
Similarity:182/415 - (43%) Gaps:125/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKVTLENFEFLKVLGKGTFGKVILCREKATAK--LYAIKILKKEVIIQKDEVAHTLTESRVLKST 321
            :.|.||:|..||.||.|..|.|.||:.:.:.:  .||:|::.||.:..|.::.....|.::|...
plant    80 RAVGLEHFRLLKRLGSGDIGSVYLCQIRGSPETAFYAMKVVDKEAVAVKKKLGRAEMEKKILGML 144

  Fly   322 NHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHE--RIFTEDRTRFYGAEIISALGYLHSQG 384
            :|||..:|..:|:.:.....||:|..||:|:.....:  :.||...||||.||.:.||.|||..|
plant   145 DHPFCPTLYAAFEASHYSFLVMEYCPGGDLYAVRLRQPSKRFTISSTRFYAAETLVALEYLHMMG 209

  Fly   385 IIYRDLKLENLLLDKDGHIKVADFGL---C-------------------KEDI------------ 415
            |:|||||.||:|:.:|||:.::||.|   |                   .:||            
plant   210 IVYRDLKPENVLIREDGHVMLSDFDLSFKCDVVPQFLSDNDRDRGHQEDDDDISIRRKCSTPSCT 274

  Fly   416 ----------------------------------------------TYGRT-------------- 420
                                                          |:.|:              
plant   275 TTPLNPVISCFSPTSSRRRKKNVVTTTIHENAAGTSDSVKSNDVSRTFSRSPSSCSRVSNGLRDI 339

  Fly   421 ---------------TKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHD 470
                           :|:|.||.|||||||:....:|.|||||..|:.:||||.||.||...:::
plant   340 SGGCPSIFAEPINARSKSFVGTHEYLAPEVISGQGHGSAVDWWTYGIFLYEMIFGRTPFKGDNNE 404

  Fly   471 VLFTLILVEEVKFPRNITD---------EAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASI 526
            .....||...:.||:.|.:         .|::|:..||.|:||||||..|..: ||:.|.||..:
plant   405 KTLVNILKAPLTFPKVIVNSPKEYEDMVNAQDLIIKLLVKNPKKRLGSLKGSI-EIKRHEFFEGV 468

  Fly   527 NWTDLVLKKIPPPFKPQVTSDTDTR 551
            ||.  :::.|.||:.|:..:...|:
plant   469 NWA--LIRSIKPPWVPKEETSHKTK 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 109/378 (29%)
STKc_PKB 270..590 CDD:270723 116/404 (29%)
PID2NP_180238.2 STKc_phototropin_like 86..483 CDD:270726 116/399 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.