DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and rps6ka1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001071243.1 Gene:rps6ka1 / 777728 ZFINID:ZDB-GENE-060929-516 Length:310 Species:Danio rerio


Alignment Length:307 Identity:82/307 - (26%)
Similarity:135/307 - (43%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 GTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRL 339
            |:|.....|..|.|...||:|::.|......:|:      ..:|:...||.:|:||..:....::
Zfish     2 GSFSVCKRCIHKVTNTEYAVKVIDKTSTDPTEEI------EILLRYGQHPNIITLKDVYDNGKQV 60

  Fly   340 CFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLL-LDKDGH- 402
            ..|.:.:.||||...:..::.|:|.........|...:.||||||:::||||..|:| :|:.|: 
Zfish    61 YLVTELMRGGELLDRILKQKFFSEREASAVLHTITKTVEYLHSQGVVHRDLKPSNILYVDESGNP 125

  Fly   403 --IKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFY 465
              :::.|||..|:.........|.|.|..::|||||....|.:..|.|..||::|.||.|..||.
Zfish   126 ESLRICDFGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGVLLYTMIAGFTPFA 190

  Fly   466 NRDHDVLFTLILVEEV-------KFPRN------ITDEAKNLLAGLLAKDPKKRLGGGKDDVKEI 517
            |...|.      .||:       :|...      ::|.||:|::.:|..||.:||     ..:::
Zfish   191 NGPEDT------PEEILSRIGSGRFTLTGGNWDAVSDAAKDLVSKMLHVDPHQRL-----TARQV 244

  Fly   518 QAHPFFA----------------------SINWTDLVLKKIPPPFKP 542
            ..||:..                      :..::.|...:.||..||
Zfish   245 LKHPWIVQRDKLPNSQLQHQDAKLVKGAMAATYSALKSSQPPPELKP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 77/264 (29%)
STKc_PKB 270..590 CDD:270723 82/307 (27%)
rps6ka1NP_001071243.1 PKc_like 1..281 CDD:304357 77/295 (26%)
S_TKc 2..250 CDD:214567 77/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.