DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Rps6kb1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001107806.1 Gene:Rps6kb1 / 72508 MGIID:1270849 Length:525 Species:Mus musculus


Alignment Length:398 Identity:165/398 - (41%)
Similarity:232/398 - (58%) Gaps:39/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EQTDMT---DVDM----ATIAEDELS------------------------EQFSVQGTTCNSSGV 258
            |..||.   |:|:    ...:||||.                        |:|.:..|:.| .|.
Mouse    20 EAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEISETSVN-RGP 83

  Fly   259 KKVTLENFEFLKVLGKGTFGKVILCREKA---TAKLYAIKILKKEVIIQK-DEVAHTLTESRVLK 319
            :|:..|.||.|:|||||.:|||...|:..   |.|::|:|:|||.:|::. .:.|||..|..:|:
Mouse    84 EKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILE 148

  Fly   320 STNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQG 384
            ...|||::.|.|:|||..:|..:::|::|||||..|..|.||.||...||.|||..|||:||.:|
Mouse   149 EVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKG 213

  Fly   385 IIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWG 449
            |||||||.||::|:..||:|:.|||||||.|..|..|.|||||.||:|||:|..:.:.:|||||.
Mouse   214 IIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWS 278

  Fly   450 TGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDV 514
            .|.:||:|:.|..||...:.......||..::..|..:|.||::||..||.::...|||.|..|.
Mouse   279 LGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDA 343

  Fly   515 KEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEE 579
            .|:||||||..|||.:|:.:|:.|||||.:.|:.|...||.:||.::...:|.|.|  |...|.:
Mouse   344 GEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDST--LSESANQ 406

  Fly   580 PLFPQFSY 587
             :|..|:|
Mouse   407 -VFLGFTY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 123/260 (47%)
STKc_PKB 270..590 CDD:270723 146/322 (45%)
Rps6kb1NP_001107806.1 TOS motif 28..32 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..54 4/21 (19%)
STKc_p70S6K 94..416 CDD:270736 147/323 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..399 6/18 (33%)
Autoinhibitory domain 424..525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.