DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and SGK1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens


Alignment Length:452 Identity:200/452 - (44%)
Similarity:262/452 - (57%) Gaps:46/452 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TVRGCQIM-------TVDRPKPFTFIIRGLQWTTVIERTFAVESELERQQWTEAIRNVSSRLIDV 216
            |..||::.       .:.:|.|.||      ||. .:..|..:..:....:.:.|.|.|      
Human    90 TQSGCEVREPCNHANILTKPDPRTF------WTN-DDPAFMKQRRMGLNDFIQKIANNS------ 141

  Fly   217 GEVAMTPSEQTDMTDVDMATIAEDEL-----------SEQFSVQGTTCNSSGVKKVTLENFEFLK 270
             .....|..|:.:   .::...|.||           |:|.:: |.:.|.....    .:|.|||
Human   142 -YACKHPEVQSIL---KISQPQEPELMNANPSPPPSPSQQINL-GPSSNPHAKP----SDFHFLK 197

  Fly   271 VLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRV-LKSTNHPFLISLKYSFQ 334
            |:|||:||||:|.|.||....||:|:|:|:.|::|.|..|.::|..| ||:..||||:.|.:|||
Human   198 VIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQ 262

  Fly   335 TNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDK 399
            |.|:|.||:.|:||||||:||..||.|.|.|.|||.|||.||||||||..|:|||||.||:|||.
Human   263 TADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDS 327

  Fly   400 DGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPF 464
            .|||.:.|||||||:|.:..||.||||||||||||||....|.:.||||..|.|:|||:.|..||
Human   328 QGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPF 392

  Fly   465 YNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWT 529
            |:|:...::..||.:.::...|||:.|::||.|||.||..||| |.|||..||::|.||:.|||.
Human   393 YSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRL-GAKDDFMEIKSHVFFSLINWD 456

  Fly   530 DLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELT---PPDPTGPLGSIAE-EPLFPQFSY 587
            ||:.|||.|||.|.|:...|.|:||.|||.|.|..:   .||......|:.| ...|..|||
Human   457 DLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSY 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 13/61 (21%)
PH 107..211 CDD:278594 12/58 (21%)
S_TKc 266..523 CDD:214567 146/257 (57%)
STKc_PKB 270..590 CDD:270723 175/323 (54%)
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 146/257 (57%)
STKc_SGK 197..519 CDD:270727 175/323 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.