DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Stk32b

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_071861.1 Gene:Stk32b / 64293 MGIID:1927552 Length:414 Species:Mus musculus


Alignment Length:294 Identity:98/294 - (33%)
Similarity:160/294 - (54%) Gaps:17/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNH 323
            ::|..::|:.|:.:|||:||||.:.:::.|.|:||:|.:.|:..:::|||.:...|.::::...|
Mouse    16 EEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCVERDEVRNVFRELQIMQGLEH 80

  Fly   324 PFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYR 388
            |||::|.||||..:.:..|:..:.||:|.:||.....|||...:.|..|:..||.||....||:|
Mouse    81 PFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHR 145

  Fly   389 DLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLD-----DNDYGQAVDWW 448
            |:|.:|:|||:.||:.:.||.:... :.......:..||..|:||||..     ...|...||||
Mouse   146 DIKPDNILLDEHGHVHITDFNIATV-LKGSEKASSMAGTKPYMAPEVFQVYVDGGPGYSYPVDWW 209

  Fly   449 GTGVVMYEMICGRLPFYNRDH-----DVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 508
            ..||..||::.|..|:  ..|     |.:..:..||.|.:.....:...:||..||.|||:.|| 
Mouse   210 SLGVTAYELLRGWRPY--EIHSATPIDEILNMFKVERVHYSSTWCEGMVSLLKKLLTKDPESRL- 271

  Fly   509 GGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKP 542
               ..:::||:..:.|.:||..:..|.:.|.|.|
Mouse   272 ---SSLRDIQSMTYLADMNWDAVFEKALMPGFVP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 90/266 (34%)
STKc_PKB 270..590 CDD:270723 95/283 (34%)
Stk32bNP_071861.1 STKc_Yank1 22..283 CDD:270730 90/267 (34%)
S_TKc 23..272 CDD:214567 88/255 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.