DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and RPS6KB2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_003943.2 Gene:RPS6KB2 / 6199 HGNCID:10437 Length:482 Species:Homo sapiens


Alignment Length:399 Identity:159/399 - (39%)
Similarity:236/399 - (59%) Gaps:24/399 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKK 260
            :||.::.:|.          .||..::|::...:.::..|.:......|:..:..|:.| .|.::
Human     8 DLETEEGSEG----------EGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVN-VGPER 61

  Fly   261 VTLENFEFLKVLGKGTFGKVILCRE-KAT--AKLYAIKILKKEVIIQK-DEVAHTLTESRVLKST 321
            :....||.|:|||||.:|||...|: :.|  .|:||:|:|:|..|::. .:.|||..|..:|:|.
Human    62 IGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESV 126

  Fly   322 NHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGII 386
            .|||::.|.|:|||..:|..:::.::|||||.||..|.||.||...||.|||..|||:|||||||
Human   127 KHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGII 191

  Fly   387 YRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTG 451
            |||||.||::|...||||:.|||||||.|..|..|.|||||.||:|||:|..:.:.:|||||..|
Human   192 YRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLG 256

  Fly   452 VVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKE 516
            .:||:|:.|..||...:.......|:..::..|..:|.:|::|:...|.::|.:|:|||..|..:
Human   257 ALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAAD 321

  Fly   517 IQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTP---PDPTGPLGSIAE 578
            :|.||||..:||.||:..::.|||:|.:.|:.|...||..||.:    ||   ||.|. |...|.
Human   322 VQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQ----TPVDSPDDTA-LSESAN 381

  Fly   579 EPLFPQFSY 587
            : .|..|:|
Human   382 Q-AFLGFTY 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 3/17 (18%)
PH 107..211 CDD:278594 3/14 (21%)
S_TKc 266..523 CDD:214567 122/260 (47%)
STKc_PKB 270..590 CDD:270723 145/325 (45%)
RPS6KB2NP_003943.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/27 (19%)
S_TKc 67..328 CDD:214567 122/260 (47%)
STKc_p70S6K 70..392 CDD:270736 146/326 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..482
Nuclear localization signal. /evidence=ECO:0000269|PubMed:12529391 471..477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.