DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and RPS6KA2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_006715612.1 Gene:RPS6KA2 / 6196 HGNCID:10431 Length:761 Species:Homo sapiens


Alignment Length:342 Identity:155/342 - (45%)
Similarity:215/342 - (62%) Gaps:11/342 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 GVKKVTLENFEFLKVLGKGTFGKVILCRE---KATAKLYAIKILKKEVIIQKDEVAHTLTESRVL 318
            |.:|.....||.|||||:|::|||.|.|:   ....:|||:|:|||..:..:|.|...: |..:|
Human    78 GFEKADPSQFELLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKM-ERDIL 141

  Fly   319 KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQ 383
            ...||||::.|.|:|||..:|..::.::.||:||..||.|.:|||:..:||.||:..||.:|||.
Human   142 AEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSL 206

  Fly   384 GIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWW 448
            ||||||||.||:|||::||||:.||||.||.|.:.:...:||||.||:||||::...:.|:.|||
Human   207 GIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWW 271

  Fly   449 GTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDD 513
            ..||:|:||:.|.|||..:|......|||..::..|:.::.||::||..|..::|..|||.|.|.
Human   272 SFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCNRLGAGIDG 336

  Fly   514 VKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAE 578
            |:||:.||||.:|:|..|..|:|.|||||.|....||.:||.|||..    ||.|..|...|...
Human   337 VEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTAR----TPTDSPGVPPSANA 397

  Fly   579 EPLFPQFSYQGDMASTL 595
            ..||..||:   :||:|
Human   398 HHLFRGFSF---VASSL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 121/259 (47%)
STKc_PKB 270..590 CDD:270723 147/322 (46%)
RPS6KA2XP_006715612.1 S_TKc 87..346 CDD:214567 121/259 (47%)
STKc_RSK_N 91..407 CDD:270734 147/323 (46%)
STKc_RSK3_C 439..731 CDD:271080
Pkinase 443..700 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.