DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and RPS6KA1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001006666.1 Gene:RPS6KA1 / 6195 HGNCID:10430 Length:744 Species:Homo sapiens


Alignment Length:335 Identity:150/335 - (44%)
Similarity:210/335 - (62%) Gaps:8/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SGVKKVTLENFEFLKVLGKGTFGKVILCREKA---TAKLYAIKILKKEVIIQKDEVAHTLTESRV 317
            :|.:|....:||.|||||:|:||||.|.|:..   :..|||:|:|||..:..:|.| .|..|..:
Human    61 AGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRV-RTKMERDI 124

  Fly   318 LKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHS 382
            |...||||::.|.|:|||..:|..::.::.||:||..||.|.:|||:..:||.||:...|.:|||
Human   125 LADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS 189

  Fly   383 QGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDW 447
            .||||||||.||:|||::||||:.||||.||.|.:.:...:||||.||:||||::...:..:.||
Human   190 LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADW 254

  Fly   448 WGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKD 512
            |..||:|:||:.|.|||..:|.....||||..::..|:.::.||::||..|..::|..|||.|.|
Human   255 WSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPD 319

  Fly   513 DVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIA 577
            ..:||:.|.|:::|:|..|..::|.|||||.|....||.|||.|||..    ||.|..|...|..
Human   320 GAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSR----TPKDSPGIPPSAG 380

  Fly   578 EEPLFPQFSY 587
            ...||..||:
Human   381 AHQLFRGFSF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 120/259 (46%)
STKc_PKB 270..590 CDD:270723 145/321 (45%)
RPS6KA1NP_001006666.1 S_TKc 71..329 CDD:214567 120/258 (47%)
STKc_RSK_N 75..391 CDD:270734 145/321 (45%)
STKc_RSK1_C 425..715 CDD:271077
Pkinase 427..684 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.