DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and sgk1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_012818527.1 Gene:sgk1 / 594981 XenbaseID:XB-GENE-1003518 Length:434 Species:Xenopus tropicalis


Alignment Length:336 Identity:178/336 - (52%)
Similarity:225/336 - (66%) Gaps:6/336 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 NFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRV-LKSTNHPFLIS 328
            :|:|||::|||:||||:|.|..|..|.||:|:|:|:.|::|.|..|.::|..| ||:..||||:.
 Frog   100 DFQFLKIIGKGSFGKVLLARHNADEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVG 164

  Fly   329 LKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLE 393
            |.:||||..||.|::.|:||||||:||..||.|.|.|.|||.|||.||||||||..|:|||||.|
 Frog   165 LHFSFQTTSRLYFILDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPE 229

  Fly   394 NLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMI 458
            |:|||..|||.:.|||||||:|....||.||||||||||||||....|.:.||||..|.|:|||:
 Frog   230 NILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEML 294

  Fly   459 CGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFF 523
            .|..|||:|:...::..||.:.::...|||:.|:|||.|||.||..||: |.|:|..||:.|.||
 Frog   295 YGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARNLLEGLLQKDRTKRI-GAKNDFMEIKNHMFF 358

  Fly   524 ASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELT---PPDPTGPLGSIAE-EPLFPQ 584
            :.|||.||:.|||.|||.|.|:..:|.::||.|||.|.|..:   .||......||.| ...|..
 Frog   359 SPINWDDLINKKITPPFNPNVSGPSDLQHFDPEFTEEPVPNSIGQSPDSILITASIKEAAEAFMG 423

  Fly   585 FSYQGDMASTL 595
            |||...|.|.|
 Frog   424 FSYAPPMESYL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 143/257 (56%)
STKc_PKB 270..590 CDD:270723 172/324 (53%)
sgk1XP_012818527.1 STKc_SGK1 93..431 CDD:270753 175/331 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.