DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and rps6ka2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_699952.2 Gene:rps6ka2 / 571285 ZFINID:ZDB-GENE-090827-1 Length:733 Species:Danio rerio


Alignment Length:366 Identity:156/366 - (42%)
Similarity:224/366 - (61%) Gaps:13/366 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 MATIAEDELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCRE---KATAKLYAIK 295
            :..:.:|.:.::|.:....  ..|.:|.....||.|||||:|::|||.|.|:   ..|.:|||:|
Zfish    29 LCKLEDDSILKEFDISHHV--KEGFEKADPSQFELLKVLGQGSYGKVFLVRKIKGSDTGQLYAMK 91

  Fly   296 ILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERI 360
            :|||..:..:|.|...: |..:|...||||::.|.|:|||..:|..::.::.||:||..||.|.:
Zfish    92 VLKKATLKVRDRVRSKM-ERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVM 155

  Fly   361 FTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFC 425
            |||:..:||.||:..||.:|||.||||||||.||:|||::||||:.||||.||.|.:.:...:||
Zfish   156 FTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFC 220

  Fly   426 GTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDE 490
            ||.||:||||::...:.|:.|||..||:|:||:.|.|||..:|......|||..::..|:.::.|
Zfish   221 GTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSPE 285

  Fly   491 AKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDK 555
            .::||..|..::|..|||.|.|.|:||:.|.|||:|:|..|..::|.|||||.|....||.:||.
Zfish   286 VQSLLRALFKRNPSNRLGAGPDGVEEIKRHIFFATIDWNKLYRREIKPPFKPAVGRPEDTFHFDP 350

  Fly   556 EFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLG 596
            |||..    ||.|..|...|.....||..||:   :|:.||
Zfish   351 EFTSR----TPTDSPGVPASANAHQLFRGFSF---VATNLG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 120/259 (46%)
STKc_PKB 270..590 CDD:270723 146/322 (45%)
rps6ka2XP_699952.2 S_TKc 59..318 CDD:214567 120/259 (46%)
STKc_RSK_N 63..379 CDD:270734 146/323 (45%)
PKc_like 411..703 CDD:304357
Pkinase 415..672 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.