DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and prkcq

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_009298659.1 Gene:prkcq / 555521 ZFINID:ZDB-GENE-041210-195 Length:719 Species:Danio rerio


Alignment Length:330 Identity:150/330 - (45%)
Similarity:217/330 - (65%) Gaps:9/330 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLK-STNH 323
            |.|:::|...|:||||:||||.|...|.:.:.:|:|.|||:|::..|:|..|:.|.|||. :.:|
Zfish   386 KFTIDSFILHKMLGKGSFGKVFLAELKGSGQFFAVKALKKDVVLMDDDVECTMVERRVLSLAWDH 450

  Fly   324 PFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYR 388
            |||..|..:|||.:.|.|||:|:|||:|.:|:.....|...|:.||.||||..|.:|||:||:||
Zfish   451 PFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYR 515

  Fly   389 DLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVV 453
            ||||:|:|||.|||||:||||:|||:|.....|.||||||:|:|||:|....||.:||||..||:
Zfish   516 DLKLDNILLDTDGHIKIADFGMCKENIIGEARTCTFCGTPDYIAPEILLGQKYGTSVDWWSFGVL 580

  Fly   454 MYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVK-EI 517
            :|||:.|:.||:..|.:.||..|..::..:||.:|.:|:::|..|..::|::|||     || .|
Zfish   581 LYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTRDARDILVKLFVREPERRLG-----VKGNI 640

  Fly   518 QAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLF 582
            :.||||...:|:.|..:::.|||||.|.|..|...|||||..|...|:..|..  :.:..::.:|
Zfish   641 RQHPFFRETDWSALEERQVEPPFKPTVKSANDCSNFDKEFINEKPRLSVTDRM--MINSMDQSMF 703

  Fly   583 PQFSY 587
            ..||:
Zfish   704 ENFSF 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 125/258 (48%)
STKc_PKB 270..590 CDD:270723 147/320 (46%)
prkcqXP_009298659.1 C1_1 166..218 CDD:278556
C1_1 238..290 CDD:278556
STKc_nPKC_theta 386..716 CDD:270770 150/330 (45%)
S_TKc 392..646 CDD:214567 125/258 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.