DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Rps6ka3

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_017457618.1 Gene:Rps6ka3 / 501560 RGDID:1563860 Length:759 Species:Rattus norvegicus


Alignment Length:379 Identity:158/379 - (41%)
Similarity:227/379 - (59%) Gaps:21/379 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 IAEDEL---SEQFSVQGTTCN---SSGVKKVTLENFEFLKVLGKGTFGKVILCRE---KATAKLY 292
            :.|:|:   :|:.|::.....   ..|.:|.....||.|||||:|:||||.|.::   ....:||
  Rat    52 MGEEEINPQTEEGSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLY 116

  Fly   293 AIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSH 357
            |:|:|||..:..:|.| .|..|..:|...||||::.|.|:|||..:|..::.::.||:||..||.
  Rat   117 AMKVLKKATLKVRDRV-RTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSK 180

  Fly   358 ERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTK 422
            |.:|||:..:||.||:..||.:|||.||||||||.||:|||::||||:.||||.||.|.:.:...
  Rat   181 EVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAY 245

  Fly   423 TFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNI 487
            :||||.||:||||::...:.|:.|||..||:|:||:.|.|||..:|.....|:||..::..|:.:
  Rat   246 SFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFL 310

  Fly   488 TDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRY 552
            :.||::||..|..::|..|||.|.|.|:||:.|.||::|:|..|..::|.|||||......||.|
  Rat   311 SPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFY 375

  Fly   553 FDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSY-------QGDMASTLGTSS 599
            ||.|||.:    ||.|..|...|.....||..||:       :.....|:|..|
  Rat   376 FDPEFTAK----TPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHS 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 121/259 (47%)
STKc_PKB 270..590 CDD:270723 146/329 (44%)
Rps6ka3XP_017457618.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.