DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and dop

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster


Alignment Length:448 Identity:140/448 - (31%)
Similarity:225/448 - (50%) Gaps:71/448 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TEAIRNVSSRLIDV-----GEVAMTPSE--QTDMTDVDMA---TIAEDELSEQ------------ 245
            |.|.:.:||..:|.     |....||.:  ||.:...|.|   .:|..:::|:            
  Fly   738 TSAAKQLSSLALDAIAMDSGSGTATPQQPPQTPVATCDTAPSFALAISQMNEEKGGSSSAVGGGS 802

  Fly   246 -FSVQG---------TTCNSSGVKKVTLE--NFEFLKVLGKGTFGKVILCREKATAKLYAIKILK 298
             ..|.|         .|...||.::.:.:  :|:.:|::..|.:|.|.|.:.|.|.:.:|:|.:.
  Fly   803 SSKVAGAEGITGGSAATATGSGAQQPSPQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKIN 867

  Fly   299 KEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTE 363
            |..:|.:::|.....|..:|...::||::|:..||:|...||.||:||.||:....|.:......
  Fly   868 KNNLILRNQVEQVFAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPA 932

  Fly   364 DRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCK---------------E 413
            |..|||.||.:.|:.||||.||::||||.:|||:...||||:.||||.|               :
  Fly   933 DMARFYFAETVLAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYID 997

  Fly   414 DITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILV 478
            ..|...:.|...|||||:||||:....||:.||||..|:::||.:.|.:||:....:.||...:.
  Fly   998 SETRQFSDKQVYGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVN 1062

  Fly   479 EEVKFPRN----ITDEAKNLLAGLLAKDPKKRLG--GGKDDVKEIQAHPFFASINWTDLVLKKIP 537
            :::::|.:    :..|||::::.||.::|:.|||  .|..::||   |.:|..::|..|:.:|  
  Fly  1063 DDIEWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKE---HEYFLGMDWNSLLRQK-- 1122

  Fly   538 PPFKPQVTSDTDTRYFD-------KEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQ 588
            ..|.||::.|.||.|||       .:..||..:.|  |.|...||.  ....||:..|
  Fly  1123 AEFVPQLSHDDDTSYFDTRMDRYNHDLGGEDTDDT--DDTPVFGSF--NSYTPQYRKQ 1176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 4/10 (40%)
PH 107..211 CDD:278594 2/7 (29%)
S_TKc 266..523 CDD:214567 98/277 (35%)
STKc_PKB 270..590 CDD:270723 120/347 (35%)
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 99/283 (35%)
S_TKc 835..1110 CDD:214567 98/277 (35%)
PDZ_signaling 1506..1587 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.