DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and S6k

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:381 Identity:159/381 - (41%)
Similarity:230/381 - (60%) Gaps:30/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EQTDMTDVDMATIAEDEL--------SEQFSVQGTTCNSS---GVKKVTLENFEFLKVLGKGTFG 278
            ::.::.|||:    |.||        ..|.::|  .|..:   |..|:..::||..||||||.:|
  Fly    31 DRIELDDVDL----EPELCINLHQDTEGQETIQ--LCEENVNPGKIKLGPKDFELKKVLGKGGYG 89

  Fly   279 KVILCREKA---TAKLYAIKILKKEVII--QKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDR 338
            ||...|:.|   ..|.:|:|:|||..|:  ||| .|||..|..:|::..|||::.|.|:|||:.:
  Fly    90 KVFQVRKTAGRDANKYFAMKVLKKASIVTNQKD-TAHTRAERNILEAVKHPFIVELVYAFQTDGK 153

  Fly   339 LCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHI 403
            |..:::|::|||||.||..|.||.||.|.||.:|||.|||:||..||||||||.||:|||..||:
  Fly   154 LYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHV 218

  Fly   404 KVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRD 468
            |:.|||||||.|..|..|.|||||.||:|||:|..:.:|:|||||..|.:|::|:.|..||...:
  Fly   219 KLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAEN 283

  Fly   469 HDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVL 533
            .......||..::..|..:|.||::|:..|:.:...:|||.|.:|...:|.||||..:||.|::.
  Fly   284 RKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLA 348

  Fly   534 KKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEP--LFPQFSY 587
            :::.||.||.:.|:.|...||..|| ..:.:..||.|    :::|..  :|..|:|
  Fly   349 RRLEPPIKPLLRSEDDVSQFDTRFT-RQIPVDSPDDT----TLSESANLIFQGFTY 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 126/261 (48%)
STKc_PKB 270..590 CDD:270723 146/325 (45%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 146/326 (45%)
STKc_p70S6K 81..402 CDD:270736 146/325 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.