DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and rps6kal

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_956367.1 Gene:rps6kal / 337670 ZFINID:ZDB-GENE-030131-9616 Length:740 Species:Danio rerio


Alignment Length:399 Identity:157/399 - (39%)
Similarity:231/399 - (57%) Gaps:22/399 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 AVESELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSS 256
            |.||.|:.:     :::|||. ::..::...|.|:...|..|.....|..::...        ..
Zfish     7 AQESSLKME-----VQSVSSE-VNGHQIMDEPMEEESYTHCDEGAYKEIPITHHV--------KE 57

  Fly   257 GVKKVTLENFEFLKVLGKGTFGKVILCRE---KATAKLYAIKILKKEVIIQKDEVAHTLTESRVL 318
            |.:|.....||.|||||:|:||||.|.|:   ....:|||:|:|||..:..:|.| .|..|..:|
Zfish    58 GCEKADPSQFELLKVLGQGSFGKVFLVRKLMGPDAGQLYAMKVLKKASLKVRDRV-RTKMERDIL 121

  Fly   319 KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQ 383
            ...||||::.|.|:|||..:|..::.::.||::|..||.|.:|||:..:||.||:..||.:||:.
Zfish   122 VEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHNL 186

  Fly   384 GIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWW 448
            ||:|||||.||:|||:.||||:.||||.||.:...:...:||||.||:||||::...:.|:.|||
Zfish   187 GIVYRDLKPENILLDEAGHIKLTDFGLSKESVDQDKKAYSFCGTVEYMAPEVVNRRGHTQSADWW 251

  Fly   449 GTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDD 513
            ..||:|:||:.|.|||..:|.:....:||..::..|:.::.||:.||..|..::|..|||.|.|.
Zfish   252 SLGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSLEAQGLLRMLFKRNPSNRLGAGPDG 316

  Fly   514 VKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAE 578
            |:||:.|.||::|:|..|..:::.|||||......||..||.|||.:    ||.|..|...|...
Zfish   317 VEEIKRHTFFSTIDWNKLYRRELQPPFKPASGKPDDTFCFDPEFTAK----TPKDSPGIPPSANA 377

  Fly   579 EPLFPQFSY 587
            ..||..||:
Zfish   378 HQLFKGFSF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 7/21 (33%)
PH 107..211 CDD:278594 5/18 (28%)
S_TKc 266..523 CDD:214567 117/259 (45%)
STKc_PKB 270..590 CDD:270723 140/321 (44%)
rps6kalNP_956367.1 S_TKc 67..326 CDD:214567 117/259 (45%)
STKc_RSK_N 71..387 CDD:270734 140/321 (44%)
STKc_RSK4_C 415..709 CDD:271079
S_TKc 420..677 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.