DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Rps6ka6

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001178650.1 Gene:Rps6ka6 / 317203 RGDID:1560817 Length:860 Species:Rattus norvegicus


Alignment Length:526 Identity:174/526 - (33%)
Similarity:264/526 - (50%) Gaps:69/526 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 RSKPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRGLQW-----TTVIER---TFAVESE 196
            |..|:...|..|..|...|...||:..:..|.:..|.::..|::     :.|.:|   ::..:.|
  Rat     8 RHTPSGHRSNSSLNLFCCFPFFGCRRQSRSRQRAGTPVVPLLRYPPLARSAVTQRESWSYEEDHE 72

  Fly   197 LERQQWTEAIRNVSSRLIDVGEVAMTP-------------------------------------- 223
            ..:|.....:...||....|.|.||.|                                      
  Rat    73 PAQQAGCMLVLGTSSFFSSVPEAAMLPFAPVEDPWDEEMEVFGSGSTSSSEPQIVFTMKTAAMVI 137

  Fly   224 --SEQTDMTDVDMATIAEDELSEQF--------SVQGTTCNSSGVKKVTLENFEFLKVLGKGTFG 278
              .|..::.|:.|.....||....|        .:..|.....|.:|.....|:.|||||:|:||
  Rat   138 RQHEHKEVNDLKMVDEPMDEGEPVFCRREDLVKEIPITQHVKEGYEKADPAQFDLLKVLGQGSFG 202

  Fly   279 KVILCREKA---TAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLC 340
            ||.|.|:|.   ..:|||:|:|:|..:..:|.| .|..|..:|...||||::.|.|:|||..:|.
  Rat   203 KVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRV-RTKMERDILVEVNHPFIVKLHYAFQTEGKLY 266

  Fly   341 FVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKV 405
            .::.::.||::|..||.|.:|||:..:||.||:..||.:||..||:|||||.||:|||:.||||:
  Rat   267 LILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLHRLGIVYRDLKPENILLDEIGHIKL 331

  Fly   406 ADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHD 470
            .||||.||.:...:...:||||.||:||||::...:.|:.|||..||:|:||:.|.|||..:|.:
  Rat   332 TDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRN 396

  Fly   471 VLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKK 535
            ....:||..::..|:.::.||::||..|..::|..||  |.:.|:|::.|.||:||:|..|..::
  Rat   397 ETMNMILKAKLGMPQFLSAEAQSLLRMLFKRNPANRL--GSEGVEEVKRHAFFSSIDWNKLYKRE 459

  Fly   536 IPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSH 600
            :.|||:|......||..||.|||.:    ||.|..|...|.....||..||:   :|:::.....
  Rat   460 VQPPFRPASGKPDDTFCFDPEFTAK----TPKDSPGLPASANAHQLFKGFSF---VATSIAEEYK 517

  Fly   601 ISTSTS 606
            |:..||
  Rat   518 ITPVTS 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 17/81 (21%)
PH 107..211 CDD:278594 15/78 (19%)
S_TKc 266..523 CDD:214567 113/259 (44%)
STKc_PKB 270..590 CDD:270723 137/322 (43%)
Rps6ka6NP_001178650.1 S_TKc 190..447 CDD:214567 113/259 (44%)
STKc_RSK_N 194..508 CDD:270734 137/323 (42%)
STKc_RSK_C 543..829 CDD:270993
Pkinase 543..800 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.