DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and STK32C

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_011537990.1 Gene:STK32C / 282974 HGNCID:21332 Length:504 Species:Homo sapiens


Alignment Length:329 Identity:105/329 - (31%)
Similarity:169/329 - (51%) Gaps:33/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSEQFSVQGTTCNS-----------SGV----KKVTLENFEFLKVLGKGTFGK-----VILCREK 286
            |:...:.:||...|           .||    |::..::|:.|:.:|||:|||     |.:.:::
Human    67 LASGLAARGTQTQSVLFGEVRLPLDGGVRGARKRMNFDHFQILRAIGKGSFGKPCALQVCIVQKR 131

  Fly   287 ATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGEL 351
            .|.|:||:|.:.|:..|::|||.:...|..:|:...|.||::|.||||..:.:..|:..:.||:|
Human   132 DTEKMYAMKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDL 196

  Fly   352 FWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDIT 416
            .:||.....|:||..|.|..|:..||.||..|.||:||:|.:|:|||:.||..:.||.:. ..|.
Human   197 RYHLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIA-TIIK 260

  Fly   417 YGRTTKTFCGTPEYLAPEVLDD-----NDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLI 476
            .|.......||..|:|||:...     ..|...||||..||:.||::.|..|:.....:.:.:|:
Human   261 DGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSSNAVESLV 325

  Fly   477 LV---EEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPP 538
            .:   ..|::....:.|...||..||..:|:.||    ..::::||.|..|.:.|..|..|::.|
Human   326 QLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRL----SSLQDVQAAPALAGVLWDHLSEKRVEP 386

  Fly   539 PFKP 542
            .|.|
Human   387 GFVP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 91/269 (34%)
STKc_PKB 270..590 CDD:270723 96/286 (34%)
STK32CXP_011537990.1 STKc_Yank1 105..371 CDD:270730 91/270 (34%)
S_TKc 106..366 CDD:214567 88/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.