DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Stk32a

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_848864.1 Gene:Stk32a / 269019 MGIID:2442403 Length:398 Species:Mus musculus


Alignment Length:292 Identity:103/292 - (35%)
Similarity:166/292 - (56%) Gaps:19/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPF 325
            |..::||.|:.:|||:||||.:.|:..|.|:||:|.:.|:..::::||.:...|.::::...|||
Mouse    18 VNFDHFEILRAIGKGSFGKVCIVRKNDTKKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPF 82

  Fly   326 LISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDL 390
            |::|.||||..:.:..|:..:.||:|.:||.....|.||..:.:..|:..||.||.||.||:||:
Mouse    83 LVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRDM 147

  Fly   391 KLENLLLDKDGHIKVADFGLC----KEDITYGRTTKTFCGTPEYLAPEVL---DDNDYGQAVDWW 448
            |.:|:|||:.||:.:.||.:.    ||.    |.| |..||..|:|||:.   .:..|..|||||
Mouse   148 KPDNILLDEHGHVHITDFNIAAMLPKET----RIT-TVAGTKPYMAPEMFTSRKETGYSFAVDWW 207

  Fly   449 GTGVVMYEMICGRLPFYNRDHDVLFTLILVEE---VKFPRNITDEAKNLLAGLLAKDPKKRLGGG 510
            ..||..||::.||.|::.|.......::.:.|   |.:|...:.|..:||..||..:|.:|.   
Mouse   208 SLGVTAYELLRGRRPYHIRSSTSSKEIVNMFETAIVTYPSAWSQEMVSLLKKLLEPNPDQRF--- 269

  Fly   511 KDDVKEIQAHPFFASINWTDLVLKKIPPPFKP 542
             ..:.:||..|:.:.:||..::.|::.|.|.|
Mouse   270 -SHLTDIQNFPYMSDMNWDAVLQKRLIPGFIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 96/266 (36%)
STKc_PKB 270..590 CDD:270723 99/283 (35%)
Stk32aNP_848864.1 STKc_Yank1 22..281 CDD:270730 96/267 (36%)
S_TKc 23..270 CDD:214567 93/255 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.