DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Prkcz

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_038965237.1 Gene:Prkcz / 25522 RGDID:3399 Length:605 Species:Rattus norvegicus


Alignment Length:394 Identity:157/394 - (39%)
Similarity:235/394 - (59%) Gaps:48/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 AMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTC--------------------NSSGVKKVT-- 262
            ::.||::..:.|.:.......|.::..::..|.|                    :|..:|.|.  
  Rat   186 SVMPSQEPPVDDKNDGVDLPSEETDGIALHSTWCATARPVAYISSSRKHDNIKDDSEDLKPVIDG 250

  Fly   263 -----------LENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESR 316
                       |::|:.::|:|:|::.||:|.|.|...::||:|::|||::...:::....||..
  Rat   251 VDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKH 315

  Fly   317 VL-KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYL 380
            |. :::::|||:.|...|||..||..|::|||||:|.:|:..:|...|:..|||.|||..||.:|
  Rat   316 VFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFL 380

  Fly   381 HSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAV 445
            |.:|||||||||:|:|||.|||||:.|:|:|||.:..|.||.||||||.|:|||:|...:||.:|
  Rat   381 HERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSV 445

  Fly   446 DWWGTGVVMYEMICGRLPF----YNRD---HDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDP 503
            |||..||:|:||:.||.||    .|.|   .|.||.:||.:.::.||.::.:|.::|.|.|.|||
  Rat   446 DWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDP 510

  Fly   504 KKRLG----GGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVEL 564
            |:|||    .|..|:|   :|.||.||:|..|..|:..|||:||:|.|.....||.:||.|.|:|
  Rat   511 KERLGCRPQTGFSDIK---SHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQL 572

  Fly   565 TPPD 568
            ||.|
  Rat   573 TPDD 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 123/268 (46%)
STKc_PKB 270..590 CDD:270723 146/311 (47%)
PrkczXP_038965237.1 PB1_aPKC 16..98 CDD:99725
C1_aPKC_zeta 129..183 CDD:410448
STKc_aPKC_zeta 249..605 CDD:270768 148/331 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.