DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Prkca

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_038941139.1 Gene:Prkca / 24680 RGDID:3395 Length:722 Species:Rattus norvegicus


Alignment Length:491 Identity:185/491 - (37%)
Similarity:261/491 - (53%) Gaps:89/491 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QWTTVIERTFAVE-SELERQ------QWTEAIRN--VSSRLIDVGEVAMTPS---------EQTD 228
            ||....  ||.:: |:.:|:      .|....||  :.|....|.|:...|:         |:.:
  Rat   222 QWNESF--TFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGE 284

  Fly   229 MTDVDMATIAED---ELSEQF--SVQGTTCN------------SSGVKKVTLENFEFLKVLGKGT 276
            ..:|.:....|:   ||.::|  :..|...|            |:.:.:|.|.:|.||.|||||:
  Rat   285 YYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGS 349

  Fly   277 FGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNH-PFLISLKYSFQTNDRLC 340
            ||||:|...|.|.:|||||||||:|:||.|:|..|:.|.|||...:. |||..|...|||.|||.
  Rat   350 FGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLY 414

  Fly   341 FVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKV 405
            |||:|||||:|.:|:.....|.|.:..||.|||...|.:||.:|||||||||:|::||.:||||:
  Rat   415 FVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKI 479

  Fly   406 ADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHD 470
            ||||:|||.:..|.||:||||||:|:|||::....||::||||..||::|||:.|:.||...|.|
  Rat   480 ADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDED 544

  Fly   471 VLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKK 535
            .||..|:...|.:|::::.||.::..||:.|.|.||||.|.:..::::.|.||..|:|..|..::
  Rat   545 ELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENRE 609

  Fly   536 IPPPFKPQVTSDTDTR------------------------------------------------- 551
            |.|||||:|....:.|                                                 
  Rat   610 IQPPFKPKVQCTAEVRGFTAFSTQLFLILDISNSSPLSVLILQNFCTKMHWLQWASRPSCGKGAE 674

  Fly   552 YFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSY 587
            .|||.||.....|||||.. .:.:| ::..|..|||
  Rat   675 NFDKFFTRGQPVLTPPDQL-VIANI-DQSDFEGFSY 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 10/40 (25%)
PH 107..211 CDD:278594 9/37 (24%)
S_TKc 266..523 CDD:214567 133/257 (52%)
STKc_PKB 270..590 CDD:270723 158/368 (43%)
PrkcaXP_038941139.1 C1_cPKC_rpt1 35..92 CDD:410383
C1_cPKC_rpt2 102..155 CDD:410386
C2_PKC_alpha_gamma 159..289 CDD:175992 14/68 (21%)
PKc_like 328..718 CDD:419665 164/383 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.