DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and STK32A

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001274669.1 Gene:STK32A / 202374 HGNCID:28317 Length:407 Species:Homo sapiens


Alignment Length:293 Identity:98/293 - (33%)
Similarity:162/293 - (55%) Gaps:21/293 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPF 325
            |..::||.|:.:|||:||||.:.::..|.|:||:|.:.|:..::::||.:...|.::::...|||
Human    18 VNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPF 82

  Fly   326 LISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDL 390
            |::|.||||..:.:..|:..:.||:|.:||.....|.|:..:.:..|::.||.||.:|.||:||:
Human    83 LVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQRIIHRDM 147

  Fly   391 KLENLLLDKDGHIKVADFGLC-----KEDITYGRTTKTFCGTPEYLAPEVLDDN---DYGQAVDW 447
            |.:|:|||:.||:.:.||.:.     :..||      |..||..|:|||:....   .|..||||
Human   148 KPDNILLDEHGHVHITDFNIAAMLPRETQIT------TMAGTKPYMAPEMFSSRKGAGYSFAVDW 206

  Fly   448 WGTGVVMYEMICGRLPFYNRDHDVLFTLILVEE---VKFPRNITDEAKNLLAGLLAKDPKKRLGG 509
            |..||..||::.||.|::.|.......::...|   |.:|...:.|..:||..||..:|.:|.  
Human   207 WSLGVTAYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRF-- 269

  Fly   510 GKDDVKEIQAHPFFASINWTDLVLKKIPPPFKP 542
              ..:.::|..|:...|||..:..|::.|.|.|
Human   270 --SQLSDVQNFPYMNDINWDAVFQKRLIPGFIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 90/267 (34%)
STKc_PKB 270..590 CDD:270723 94/284 (33%)
STK32ANP_001274669.1 STKc_Yank1 22..281 CDD:270730 90/268 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.