DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Rps6ka1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001365809.1 Gene:Rps6ka1 / 20111 MGIID:104558 Length:741 Species:Mus musculus


Alignment Length:368 Identity:155/368 - (42%)
Similarity:221/368 - (60%) Gaps:19/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 PSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKA 287
            |..|.|         :::.:.::.|:  |....:|.:|.....||.|||||:|:||||.|.|:..
Mouse    36 PGPQQD---------SDEAILKEISI--THHVKAGSEKADPSQFELLKVLGQGSFGKVFLVRKVT 89

  Fly   288 ---TAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGG 349
               :..|||:|:|||..:..:|.| .|..|..:|...||||::.|.|:|||..:|..::.::.||
Mouse    90 RPDSGHLYAMKVLKKATLKVRDRV-RTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGG 153

  Fly   350 ELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKED 414
            :||..||.|.:|||:..:||.||:...|.:|||.||||||||.||:|||::||||:.||||.||.
Mouse   154 DLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEA 218

  Fly   415 ITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVE 479
            |.:.:...:||||.||:||||::...:..:.|||..||:|:||:.|.|||..:|.....||||..
Mouse   219 IDHEKKAYSFCGTVEYMAPEVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKA 283

  Fly   480 EVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQV 544
            ::..|:.::.||::||..|..::|..|||.|.|..:||:.|.|:::|:|..|..::|.|||||.|
Mouse   284 KLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHIFYSTIDWNKLYRREIKPPFKPAV 348

  Fly   545 TSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSY 587
            ....||.|||.|||..    ||.|..|...|.....||..||:
Mouse   349 AQPDDTFYFDTEFTSR----TPRDSPGIPPSAGAHQLFRGFSF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 120/259 (46%)
STKc_PKB 270..590 CDD:270723 145/321 (45%)
Rps6ka1NP_001365809.1 STKc_RSK_N 72..388 CDD:270734 145/321 (45%)
STKc_RSK1_C 422..712 CDD:271077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.