DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Prkch

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_032882.2 Gene:Prkch / 18755 MGIID:97600 Length:683 Species:Mus musculus


Alignment Length:343 Identity:176/343 - (51%)
Similarity:231/343 - (67%) Gaps:12/343 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTE 314
            |...|||  .:..::||||::|||||:||||:|.|.|.|.:|||:|:|||:||:|.|:|..|:||
Mouse   341 GIGVNSS--SRFGIDNFEFIRVLGKGSFGKVMLARIKETGELYAVKVLKKDVILQDDDVECTMTE 403

  Fly   315 SRVLK-STNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALG 378
            .|:|. :.|||||..|...|||.|||.|||::||||:|.:|:...|.|.|.|.|||.|||||||.
Mouse   404 KRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALM 468

  Fly   379 YLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQ 443
            :||.:|||||||||:|:|||.:||.|:||||:|||.|..|.||.||||||:|:|||:|.:..||.
Mouse   469 FLHEKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGP 533

  Fly   444 AVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 508
            |||||..||::|||:||..||...:.|.||..||.:||.:|..:.::|..:|...:.|:|..|||
Mouse   534 AVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLG 598

  Fly   509 ----GGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDP 569
                ||:   .||..||||..|:|..|..:::.|||:|::.|..|...||.:|..|...|||.| 
Mouse   599 SLTQGGE---HEILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPID- 659

  Fly   570 TGPLGSIAEEPLFPQFSY 587
            .|.|..|.::. |..|||
Mouse   660 EGHLPMINQDE-FRNFSY 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 145/261 (56%)
STKc_PKB 270..590 CDD:270723 168/323 (52%)
PrkchNP_032882.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..222 CDD:365894
C1_1 246..296 CDD:365894
STKc_nPKC_eta 359..681 CDD:270742 168/323 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.