DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and F31E3.2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_498522.3 Gene:F31E3.2 / 175977 WormBaseID:WBGene00017950 Length:441 Species:Caenorhabditis elegans


Alignment Length:284 Identity:97/284 - (34%)
Similarity:148/284 - (52%) Gaps:20/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ENFEFLKVLGKGTFGKVILCREKA--TAKLYAIKILKKEVIIQKDEVAHTLTES---RVLKSTNH 323
            ::|...:.||:|:|| |:.|....  :.:.:|||:.:|..||.|..|.....|:   |:|.|  |
 Worm   124 KSFVLERQLGRGSFG-VVYCASAIHDSERKFAIKMQEKREIISKRAVLQVKREASIQRLLPS--H 185

  Fly   324 PFLISLKYSFQTNDRLCFVMQYVNG--GELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGII 386
            ||:.....::||...|..::||..|  |:||.........:|...|..|||:.||:.:||...:|
 Worm   186 PFIARTYSTWQTRTHLYSLLQYPTGSTGDLFSVWRQRGSLSEAAIRLIGAELASAIDFLHQNDVI 250

  Fly   387 YRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTG 451
            |||:||||::||:.||..:.||||.|: :..|.:|.|.|||.:|::|:|.....|...||||..|
 Worm   251 YRDVKLENVVLDQWGHALLIDFGLAKK-LKQGSSTGTICGTLQYMSPDVASGGTYSHYVDWWSLG 314

  Fly   452 VVMYEMICGRLPFYNRD--HDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDV 514
            |:::.::.|..|:.|.:  |......|   :...|...:.|..||:..:||.....||    ...
 Worm   315 VLLHILLTGIYPYPNSEATHHANLKFI---DYSTPIGCSREFANLMDRMLAVSITHRL----CSF 372

  Fly   515 KEIQAHPFFASINWTDLVLKKIPP 538
            ..:.|||||.||:::.|..|...|
 Worm   373 TVLHAHPFFRSIDFSKLEQKDYTP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 90/265 (34%)
STKc_PKB 270..590 CDD:270723 96/278 (35%)
F31E3.2NP_498522.3 S_TKc 126..381 CDD:214567 90/265 (34%)
STKc_AGC 132..381 CDD:270693 89/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.