DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and PHETA1

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001171467.1 Gene:PHETA1 / 144717 HGNCID:26509 Length:262 Species:Homo sapiens


Alignment Length:103 Identity:28/103 - (27%)
Similarity:49/103 - (47%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADSAS-TPSDFLLNNFTVRGCQIMTVDRPKPF 174
            |:|.|:|.....:.:|:|||.  |.::.|..   |:|| .|...::    :.||.:..|:..:.|
Human    35 GFLYKKGGRHAAYHRRWFVLR--GNMLFYFE---DAASREPVGVII----LEGCTVELVEAAEEF 90

  Fly   175 TFIIR--GLQWTTVIERTFAVESELERQQWTEAIRNVS 210
            .|.:|  |.:..|.:   .|.||:...:.|.:|:...|
Human    91 AFAVRFAGTRARTYV---LAAESQDAMEGWVKALSRAS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 28/103 (27%)
PH 107..211 CDD:278594 28/103 (27%)
S_TKc 266..523 CDD:214567
STKc_PKB 270..590 CDD:270723
PHETA1NP_001171467.1 PH_Ses 24..143 CDD:270105 28/103 (27%)
PH 35..125 CDD:278594 27/101 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.