DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt1 and Rps6ka2

DIOPT Version :9

Sequence 1:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_038934903.1 Gene:Rps6ka2 / 117269 RGDID:620676 Length:762 Species:Rattus norvegicus


Alignment Length:392 Identity:165/392 - (42%)
Similarity:232/392 - (59%) Gaps:23/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 EVAMTPSEQTDMTDVDMATIAEDE-------LSEQFSVQGTTCNS---SGVKKVTLENFEFLKVL 272
            ::..||.:.|:....|....||.:       ..|:..|:....:|   .|.:|.....||.||||
  Rat    30 DIEPTPEDTTEEGKGDTTASAETQPASSSSSAEEEGIVKEIDISSHVKEGFEKADPSQFELLKVL 94

  Fly   273 GKGTFGKVILCREKAT----AKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSF 333
            |:|::|||.|.| |.|    .:|||:|:|||..:..:|.|...: |..:|...||||::.|.|:|
  Rat    95 GQGSYGKVFLVR-KVTGSDAGQLYAMKVLKKATLKVRDRVRSKM-ERDILAEVNHPFIVKLHYAF 157

  Fly   334 QTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLD 398
            ||..:|..::.::.||:||..||.|.:|||:..:||.||:..||.:||..||||||||.||:|||
  Rat   158 QTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLD 222

  Fly   399 KDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLP 463
            ::||||:.||||.||.|.:.:...:||||.||:||||::...:.|:.|||..||:|:||:.|.||
  Rat   223 EEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLP 287

  Fly   464 FYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINW 528
            |..:|......|||..::..|:.::.||::||..|..::|..|||.|.|.|:||:.||||.:|:|
  Rat   288 FQGKDRKETMALILKAKLGMPQFLSAEAQSLLRALFKRNPCNRLGAGVDGVEEIKRHPFFVTIDW 352

  Fly   529 TDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMAS 593
            ..|..|:|.|||||.|....||.:||.|||..    ||.|..|...|.....||..||:   :||
  Rat   353 NKLYRKEIKPPFKPAVGRPEDTFHFDPEFTAR----TPTDSPGVPPSANAHHLFRGFSF---VAS 410

  Fly   594 TL 595
            :|
  Rat   411 SL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 122/260 (47%)
STKc_PKB 270..590 CDD:270723 148/323 (46%)
Rps6ka2XP_038934903.1 STKc_RSK_N 92..408 CDD:270734 148/324 (46%)
STKc_RSK3_C 440..732 CDD:271080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.