DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and LNX1

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001119800.1 Gene:LNX1 / 84708 HGNCID:6657 Length:728 Species:Homo sapiens


Alignment Length:624 Identity:124/624 - (19%)
Similarity:194/624 - (31%) Gaps:236/624 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SLTDTTNSSFATPPFSLSPVGESQGIDRWARVHAFEDVELPLPPVQLVKLPPPRQ---------- 337
            |||.|..|...:...::|.:.:..|:|..|.|.:.||.:..:.||...:....|.          
Human   154 SLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARPFERSTIRS 218

  Fly   338 ----------LVIRRQKS------------------------PR-----QDFGFSLRKAICLDRT 363
                      .|:||.||                        ||     .|...:..|...:|.:
Human   219 RSFKKINRALSVLRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPS 283

  Fly   364 ESLT--------SP--------IFRPVIFAEPGAGGGATGLLPGDRLIKVNGTPVGELPREIIIE 412
            |||:        :|        |:|..:.|..|.      |||||.::||||..:..:|....:.
Human   284 ESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGR------LLPGDIILKVNGMDISNVPHNYAVR 342

  Fly   413 MI-------------------RNSGEA-------------VTVEVQPVAEL-VELSKRCMAPST- 443
            ::                   ||:|:|             :..:..|..:| ::|.::...|.. 
Human   343 LLRQPCQVLWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVF 407

  Fly   444 -------------ATVEEID-------HSITNGNCNTLRR--SASKR-----------------F 469
                         ..:||.|       |.:..|:..:...  .||:|                 |
Human   408 IFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIF 472

  Fly   470 KRQSRHENGN---GGGEEGGA------------------KGVGHDLEADVADASQPERVW----- 508
            :....:.||:   |.||....                  |..|..|...||..:. .|.|     
Human   473 QEAGWNSNGSWSPGPGERSNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGAS-HREWDLPIY 536

  Fly   509 --LVHRGGFTAAIRLPTASSGRDEENKLSLRLLH-NGEQLTVDEDDVEKQNSPALDLVEDICELK 570
              .|..||..:          ||...|....||: :|.:||    :|.:..:.||        ||
Human   537 VISVEPGGVIS----------RDGRIKTGDILLNVDGVELT----EVSRSEAVAL--------LK 579

  Fly   571 YLNEASVLHCLR-QRYASNLIHTKAGPTLLVVN-PMAPLSLYSEKVVSMFRGCKTEDMPPHVYSL 633
            ..:.:.||..|. :.|...  ...:.|..|..| .|||.|.:|...|...      ::|..:|:.
Human   580 RTSSSIVLKALEVKEYEPQ--EDCSSPAALDSNHNMAPPSDWSPSWVMWL------ELPRCLYNC 636

  Fly   634 AQTAYRSLVETRRDQSLIFMGRSGSGKSTSFKHALNYLALAAGAYNNFINAEKVNALCTILEAFG 698
            ..               |.:.|:.:| |..|        ...|.|..: |..|...:.:|:|.  
Human   637 KD---------------IVLRRNTAG-SLGF--------CIVGGYEEY-NGNKPFFIKSIVEG-- 674

  Fly   699 NTKTCLNSNATRMTQ-LLSLDFDQTGQIASASLQVLLPE 736
              ....|....|... ||:::...|..:..|.|..||.|
Human   675 --TPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKE 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 32/163 (20%)
MYSc 556..1317 CDD:214580 40/184 (22%)
MYSc_Myo18 575..1305 CDD:276837 36/165 (22%)
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
LNX1NP_001119800.1 mRING-HC-C3HC3D_LNX1 38..79 CDD:319693
modified RING-HC finger (C3HC3D-type) 41..78 CDD:319693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 9/35 (26%)
NPXY motif 181..184 0/2 (0%)
Interaction with MAGEB18. /evidence=ECO:0000269|PubMed:20864041 186..244 10/57 (18%)
PDZ_signaling 272..355 CDD:238492 20/88 (23%)
PDZ_signaling 380..460 CDD:238492 12/79 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..494 5/18 (28%)
PDZ_signaling 505..588 CDD:238492 24/105 (23%)
PDZ_signaling 637..721 CDD:238492 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.