DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_075542.2 Gene:Slc9a3r2 / 65962 MGIID:1890662 Length:337 Species:Mus musculus


Alignment Length:214 Identity:56/214 - (26%)
Similarity:82/214 - (38%) Gaps:40/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 PPRQL---VIRRQKSPRQDFGFSLRKAICLDRTESLTSPIFRPVIFAEPGAGGGATGLLPGDRLI 395
            |||:|   :...::.| |.:||:|..      .:|......|.|   :||:....:||...||||
Mouse   143 PPRELRPRLCHLRRGP-QGYGFNLHS------DKSRPGQYIRSV---DPGSPASHSGLRAQDRLI 197

  Fly   396 KVNGTPV-GELPREIIIEMIRNSGEAVTVEVQPVAELVELSKRC-MAPSTATVE-EIDHSITNGN 457
            :|||..| |....|::..:.....||..:.|.|  |..|..||. :.|:...|| .:...:|||.
Mouse   198 EVNGQNVEGLRHAEVVARIKAQEDEARLLVVDP--ETDEHFKRLRVIPTEEHVEGPLPSPVTNGT 260

  Fly   458 CNTLRRSASKRFKRQ----SRHENGNGGG------EEGGAKGVGHDLEADVADASQPERVWLVHR 512
            ........|....|.    |..:|.:|..      :|.|.     .|....|:|.:..|...|::
Mouse   261 SPAQLNGGSVCSSRSDLPGSEKDNEDGSTWKRDPFQESGL-----HLSPTAAEAKEKARATRVNK 320

  Fly   513 GGFTAAIRLPTASSGRDEE 531
                   |.|.....|..|
Mouse   321 -------RAPQMDWNRKRE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 24/87 (28%)
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
Slc9a3r2NP_075542.2 PDZ_signaling 9..88 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..147 3/3 (100%)
PDZ 148..230 CDD:214570 25/91 (27%)
EBP50_C 232..337 CDD:286142 25/113 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..337 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.