DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Pdzk1

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:313 Identity:72/313 - (23%)
Similarity:114/313 - (36%) Gaps:87/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 ARVHAFEDVELPLPPVQLVKLP-PPRQLVIRRQKSPRQDFGFSLRKAICLDRTESLTSPIFRPVI 375
            ||.|:.:..........|..|| .||.:||::..:   .:||.||..      ......|.:.: 
  Rat   217 ARCHSEQKTPFKRETASLKLLPHQPRVVVIKKGSN---GYGFYLRAG------PEQKGQIIKDI- 271

  Fly   376 FAEPGAGGGATGLLPGDRLIKVNGTPVGELPREIIIEMIRNSGEAVTV-----EVQPVAELVELS 435
              |||:...|.||...|.::.|||..|..|..:.::|||||.|:..|:     |...:..|...|
  Rat   272 --EPGSPAEAAGLKNNDLVVAVNGESVEALDHDSVVEMIRNGGDQTTLLVLDKEADRIYSLARFS 334

  Fly   436 K--RCM---------------------APSTATVEEI-DHSITNGNCNTLRRSASKRFKRQS-RH 475
            .  .|.                     ||.:||.|:: ||.  ...|..::...|..|...: |.
  Rat   335 PLLYCQSQELPNGSVKEAPAPISAPLEAPGSATTEDVGDHK--PKLCRLIKEDDSYGFHLNAIRG 397

  Fly   476 ENGN--------GGGEEGGAKGV-------GHDLEADVAD------ASQPERVWLVHRG----GF 515
            :.|:        |..::.|.:..       |.:::.:..|      .|..|.|.|:..|    .:
  Rat   398 QPGSFVKEVQQGGPADKAGLENEDIIIEVNGENVQDEPYDRVVERIKSSGEHVTLLVCGKVAYSY 462

  Fly   516 TAAIRLPTASS-------GRDEENKLSLRLLHNGEQLTVDEDDVEKQNSPALD 561
            ..|.::|..||       |.||:.:..    |:..:.|.|      .:.||.|
  Rat   463 FQAKKIPILSSLADPLVAGPDEKGETE----HDSAESTKD------SSHPARD 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 27/91 (30%)
MYSc 556..1317 CDD:214580 3/6 (50%)
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570
PDZ_signaling 242..320 CDD:238492 27/89 (30%)
PDZ 375..455 CDD:214570 13/81 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.