DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and SYNJ2BP

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_060843.2 Gene:SYNJ2BP / 55333 HGNCID:18955 Length:145 Species:Homo sapiens


Alignment Length:49 Identity:17/49 - (34%)
Similarity:28/49 - (57%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 EPGAGGGATGLLPGDRLIKVNGTPVGELPREIIIEMIRNSGEAVTVEVQ 426
            |.||......|..||:::.|||..:..|..:..:::.||:|.||::.||
Human    49 ENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 15/47 (32%)
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
SYNJ2BPNP_060843.2 PDZ_signaling 13..97 CDD:238492 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.