DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Zasp66

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:465 Identity:87/465 - (18%)
Similarity:148/465 - (31%) Gaps:166/465 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SRASNGAGVSVNYSEVTHSLLSG-GLKNRFLPPIPPKPP-----------------KR------- 165
            ||:|    .|.::|......:.| .|...:.|...||||                 ||       
  Fly     4 SRSS----ASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADEQ 64

  Fly   166 --GILKGSRSN--------MTNVHE----EISFAGSA---GGAGGTPEMLLRNTFQNESLY-EGA 212
              |:..||.::        ::.:.|    ::|.|.:.   .|||....:::..  .|:..| :||
  Fly    65 NVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHR--DNKIAYTQGA 127

  Fly   213 ARGAGSIGSNSSQHGTSFTSVESLRSDGEQTGGQ----------QRAMTLPANA-RYGALPQGNS 266
            .:.||. ||.|:      :::..:..|.....|.          :||:.||.:. .....||.||
  Fly   128 TQEAGP-GSRSN------STLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNS 185

  Fly   267 QGSH--LHVLTSPSPSADSL--TDTTNSSFATPPFSLSPVGESQGIDRWARVHAFEDVELPLPPV 327
            .|.:  ...:.||.|:.|..  .|...::....|:..:|                    |.||..
  Fly   186 SGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTP--------------------LVLPGA 230

  Fly   328 QLVKLPPPRQLVIRRQKSPR------QDFGFSLRKAICLDRTESLTSPIFRPVIFAEPGAGGGAT 386
            ::.|..|..:..:|...:|.      .|:..|:.|       :.:...:...|:.:|...|    
  Fly   231 KVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMK-------QRVADTMLHKVVGSEADTG---- 284

  Fly   387 GLLPGDRLI-KVNGTPVGELPREIIIEMIRNSGEAVTVEVQPVAELVELSKRCMAPSTATVEEID 450
                  |:. |...:|:|......|.:.||::....|.|                          
  Fly   285 ------RVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSE-------------------------- 317

  Fly   451 HSITNGNCNTLRRSASKR--------FKRQSRHENGNGG-----GEEGGAKGVGHDLEADV---- 498
                   .|.|:.|...|        :|:..:::..|..     .||||....|.....:|    
  Fly   318 -------SNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPV 375

  Fly   499 -ADASQPERV 507
             ....||.|:
  Fly   376 QTKVYQPNRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 17/93 (18%)
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 8/46 (17%)
DUF4749 285..359 CDD:292558 17/106 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.