DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Gopc

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001101101.2 Gene:Gopc / 309774 RGDID:1309512 Length:463 Species:Rattus norvegicus


Alignment Length:416 Identity:89/416 - (21%)
Similarity:169/416 - (40%) Gaps:88/416 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1402 LEKIECDRSEVKAENQKLEAKLSELTVDLAEERSTAHIATERLEAE-----------TAERLKLE 1455
            |.:|:.|::::..|.::....||.....|..:..|......:|||:           .||::.||
  Rat    53 LGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLE 117

  Fly  1456 KELGDQTNKVKNLQ-----ETTEKLEMELICAKSDLNGISEDEDAENEDGVGGGVYKLKYERVAR 1515
            ||:.||..::.:.|     :|.:.::...|.||..::.: ||.:.|.|   .....|:|..|:..
  Rat   118 KEVHDQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSM-EDLERELE---ANKTEKVKEARLEA 178

  Fly  1516 ELEFTKRRLHTQHEHDLEQLVALKKHLEMKLSDAY----------EEV---VEQRQVVGQWKRKA 1567
            |::..::      |::     ||::|:.:..::.|          :|:   |:|.|::|      
  Rat   179 EVKLLRK------ENE-----ALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLG------ 226

  Fly  1568 QKMTNEMNDLRMLLEEQNARNNLLEKKQRKFDAECQSLQDAVRQERQAKERYGREKDVLQAEKFT 1632
            :.|....:|  .|..:..|..:|  .:.:.....|:..|| :::..||..  |.::|.|:.    
  Rat   227 RDMKGPAHD--KLWNQLEAEIHL--HRHKTVIRACRGRQD-LKRPMQAPP--GHDQDSLKK---- 280

  Fly  1633 LEQTLADTRLDLEFKEE-----------KLASLQRELEEMTFG------GGTEEEFAQLR-RSKN 1679
             .|.:...|..|..||:           |...:...:.|:..|      ||.....|.|. ...|
  Rat   281 -SQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAVLAVNGVN 344

  Fly  1680 ETERRAKEQEEELDEMAGQIQLLEQAKLRLEMTLETMRKEARRESQQRDE-ELEEVRGNGYK--- 1740
            ..:.:.||....|.:..|:|: .|...:..|:..:....|...||..|.. .|:|:.|.|..   
  Rat   345 LRDTKHKEAVTILSQQRGEIE-FEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNSGAS 408

  Fly  1741 -KIKALECQLETEHEERTLLLREKHE 1765
             |..:.|.::...:.::|  :|:.||
  Rat   409 CKDSSGEMKVLQGYNKKT--VRDAHE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769 50/245 (20%)
COG1340 1565..1833 CDD:224259 47/224 (21%)
coiled coil 1723..1734 CDD:293879 4/11 (36%)
GopcNP_001101101.2 SMC_prok_B <35..>215 CDD:274008 37/176 (21%)
PDZ_signaling 287..369 CDD:238492 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.