DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Stxbp4

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:402 Identity:85/402 - (21%)
Similarity:154/402 - (38%) Gaps:130/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1697 GQIQLLEQAKL---RLEMTLETM-------RKEARRESQQRDEE-------------------LE 1732
            |:|.|...|:|   :|||.|..:       :.||.|:..|.|.|                   |:
  Rat   209 GKISLNPSARLKAEKLEMALNYLGIQPTKEQHEALRQQVQADSEGTVSFGDFVQVARNLFCLQLD 273

  Fly  1733 EVRGNGYKKIKALECQL----ETEHEERTLLLREKHELERRLSSMEDRDRVDRDAEEALNQKLRR 1793
            ||....::....|:.||    ..|.:|...|.:|::      :::|:||        ||.:||..
  Rat   274 EVNVGDHELPSVLDSQLLPCGSLEADEVGRLRQERN------AALEERD--------ALKEKLLE 324

  Fly  1794 DLRKYKALLKDAQTQLERLKA---DTPGKTLIRQLRNQLEDAESARSLAMKARQTAEAELTEVQA 1855
            ..:..|.|:::.|...:..||   :|      |.||:::..||:|:      ||....|:     
  Rat   325 SEKHRKQLIEELQNVKQEAKAVAEET------RALRSRIHLAEAAQ------RQARGMEM----- 372

  Fly  1856 MFDESHRARNDAEERANAAHRDRAELQAQI----EENEEELGELMKKYSATVKQLNTEQINVSEA 1916
                      |.||.......:.:||:|::    ::|:|.:.:|.|:              |:..
  Rat   373 ----------DYEEVIRLLEAEVSELKARLADYSDQNKESVQDLRKR--------------VTVL 413

  Fly  1917 EFKLNEMEAERNNLKEQVAELQHRLDNVENLGDPSMAMMSKRLELRT------------------ 1963
            :.:|.:.|..|...|.....|...::.::.:...|.|.:|...|.|.                  
  Rat   414 DCQLRKSEMARKTFKSSTERLLRFVEAIQEVLLDSCAPLSNLSERRAVLASQTSLPLLGRNGRNF 478

  Fly  1964 ---KELESRLELEQATRARLEVQVNRH-------KEALEKLQNEVTQS-----KMREMQAQDVIK 2013
               ..|||: ||.::.||.|::....:       .:.::...|.|||:     .|..:......:
  Rat   479 PAPLLLESK-ELLRSVRAVLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPMMSVLNLSCAE 542

  Fly  2014 KSQKSL-RDMRE 2024
            :|::.. |::||
  Rat   543 ESEEDCPRELRE 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769 21/85 (25%)
COG1340 1565..1833 CDD:224259 41/171 (24%)
coiled coil 1723..1734 CDD:293879 4/29 (14%)
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492
TPR_MLP1_2 299..400 CDD:285204 31/141 (22%)
GBP_C <306..389 CDD:303769 27/123 (22%)
coiled coil 359..369 CDD:293879 5/15 (33%)
coiled coil 378..389 CDD:293879 1/10 (10%)
WW 502..531 CDD:278809 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.