DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and Tamalin

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_620249.1 Gene:Tamalin / 192254 RGDID:70554 Length:394 Species:Rattus norvegicus


Alignment Length:196 Identity:42/196 - (21%)
Similarity:70/196 - (35%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 QQRAMTLPANARYGALPQGNSQGSHLHVLTSPSPSADSLTDTTNSSFATPPFSLSPVGESQGIDR 310
            ||:.....|....|..|...:      ...:|:||.             ||.:.:|.| :.|.:.
  Rat    10 QQKEEATAAPDLAGRAPDSEA------ARAAPTPSG-------------PPAAAAPPG-APGDEL 54

  Fly   311 WARVHAFEDVEL---------PLPP--------VQLVKLPPPRQLVIRRQKSPRQDFGFSLRKAI 358
            :|.:..:...||         .||.        ....:.|..::.|:..:|...|.|||.: :..
  Rat    55 YAALEDYHPAELYRALAVSGGTLPRRKGSGFRWKNFTQSPEQQRKVLTLEKGDNQTFGFEI-QTY 118

  Fly   359 CLDRTESLTSPIFRPVIFAEPGAGGGATGLLPGDRLIKVNGTPVGELPREIIIEMIRNSGEAVTV 423
            .|...|.....:...|......:.....||.|||.:..|||..|..:....|:::|:.||..:.:
  Rat   119 GLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRL 183

  Fly   424 E 424
            |
  Rat   184 E 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 23/86 (27%)
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
TamalinNP_620249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 12/60 (20%)
PDZ_signaling 99..184 CDD:238492 22/85 (26%)
Interaction with PSCD3. /evidence=ECO:0000250 180..257 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.