Sequence 1: | NP_732109.2 | Gene: | Mhcl / 41955 | FlyBaseID: | FBgn0026059 | Length: | 2194 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620249.1 | Gene: | Tamalin / 192254 | RGDID: | 70554 | Length: | 394 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 42/196 - (21%) |
---|---|---|---|
Similarity: | 70/196 - (35%) | Gaps: | 38/196 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 QQRAMTLPANARYGALPQGNSQGSHLHVLTSPSPSADSLTDTTNSSFATPPFSLSPVGESQGIDR 310
Fly 311 WARVHAFEDVEL---------PLPP--------VQLVKLPPPRQLVIRRQKSPRQDFGFSLRKAI 358
Fly 359 CLDRTESLTSPIFRPVIFAEPGAGGGATGLLPGDRLIKVNGTPVGELPREIIIEMIRNSGEAVTV 423
Fly 424 E 424 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mhcl | NP_732109.2 | PDZ_signaling | 339..426 | CDD:238492 | 23/86 (27%) |
MYSc | 556..1317 | CDD:214580 | |||
MYSc_Myo18 | 575..1305 | CDD:276837 | |||
GBP_C | <1540..1750 | CDD:303769 | |||
COG1340 | 1565..1833 | CDD:224259 | |||
coiled coil | 1723..1734 | CDD:293879 | |||
Tamalin | NP_620249.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | 12/60 (20%) | |
PDZ_signaling | 99..184 | CDD:238492 | 22/85 (26%) | ||
Interaction with PSCD3. /evidence=ECO:0000250 | 180..257 | 1/5 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 293..318 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |