DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mhcl and C50F7.3

DIOPT Version :9

Sequence 1:	NP_732109.2	Gene:	Mhcl / 41955	FlyBaseID:	FBgn0026059	Length:	2194	Species:	Drosophila melanogaster
Sequence 2:	NP_501268.1	Gene:	C50F7.3 / 183682	WormBaseID:	WBGene00016843	Length:	313	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	34/143 - (23%)
Similarity:	57/143 - (39%)	Gaps:	45/143 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly  1193 VHCYLLQHNAGK------HTKYTANG-SPSSAAG-------------------QVSSEEEMVNVP 1231
            |.|.|::::.|.      .|....:| .|.|..|                   ::.|.:.:.|
Worm   151 VVCDLVENSLGDMTFSVGETILDVDGEKPLSCTGFNERVRKSLLIRNYCLVTVEIPSTDPLKN-- 213

  Fly  1232 LLRSQLRGSQVLEAARLHRLGFPESVPL----LEFVRRFG--------LLAGDLASNKDVSVEQI 1284
            |||:|:. ..|.||.|:|:|. |::...    :..:|:||        |||..:..:.:.:..|:
Worm   214 LLRNQIT-KTVKEAPRIHKLP-PDAAAYGAEGIAVLRKFGGGEQLKPILLAEPIPKSNESAHSQL 276

  Fly  1285 L---AVNELDVAS 1294
            .   .|.|.||.|
Worm   277 KIEEKVKEGDVPS 289

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mhcl	NP_732109.2	PDZ_signaling	339..426	CDD:238492
		MYSc	556..1317	CDD:214580	34/143 (24%)
		MYSc_Myo18	575..1305	CDD:276837	34/143 (24%)
		GBP_C	<1540..1750	CDD:303769
		COG1340	1565..1833	CDD:224259
		coiled coil	1723..1734	CDD:293879
C50F7.3	NP_501268.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900