DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhcl and LOC100537963

DIOPT Version :9

Sequence 1:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster
Sequence 2:XP_003199443.3 Gene:LOC100537963 / 100537963 -ID:- Length:479 Species:Danio rerio


Alignment Length:315 Identity:95/315 - (30%)
Similarity:162/315 - (51%) Gaps:26/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 KGVGHDLEADVADASQPE--------------RVWLVHRGGFTAAIRL-PTASSGRDEENKLSLR 537
            |||..:.|..:......|              :||..|:.|:|.|.:| |...:....:.::.:|
Zfish   164 KGVRQEPEGQITVTHMKEESKVPVKDVWYEAGQVWFTHKDGYTLATQLKPDEGTPELPDGRVRVR 228

  Fly   538 LLHNGEQLTVDEDDVEKQNSPALDLVEDICELKYLNEASVLHCLRQRYASNLIHTKAGPTLLVVN 602
            |..:.....|.:.::||.|.|.|||.||:.:|..:||:|.||.|..|..::|..|.|||.||.:.
Zfish   229 LSSDQSIHDVSQYEIEKLNPPELDLCEDLSDLVSVNESSALHTLSSRAKAHLPLTHAGPNLLALW 293

  Fly   603 PMAPLSLYSEKVVSMFRGCKTE--DMPPHVYSLAQTAYRSLVETRRDQSLIFMGRSGSGKSTSFK 665
            |  |:|..::.    ||..:.|  :.|..:.::.:..|.|::..||||:|:.:|||||||:|:.:
Zfish   294 P--PVSSSTKS----FRSRRWESWEAPGPLQAVVRKVYVSMLGQRRDQTLVALGRSGSGKTTACQ 352

  Fly   666 HALNYLALAAGAYNNFINAEKVNALCTILEAFGNTKTCLNSNATRMTQLLSLDFDQTGQIASASL 730
            .....|...||.....:..|::.|:.|:|.:||...:..:..::|...:||:||:..|..|:|.|
Zfish   353 SFSLELLKQAGTAGGSLTLERLQAVFTVLRSFGCVSSTHSEASSRFAMVLSVDFNHAGLAAAAHL 417

  Fly   731 QVLLPERQRAGRRLGHEHSFHIMTRLLAGAAGLLQKELHLENITSEDSHPFISLS 785
            |.:|.|:.|..:|...|.:|.:.:::|:|.:..|:.||.|..:   ..|.|..::
Zfish   418 QTMLLEKWRVCQRPDGESNFLVFSQMLSGLSSDLRTELQLHQL---KEHNFFGIT 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580 77/232 (33%)
MYSc_Myo18 575..1305 CDD:276837 67/213 (31%)
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
LOC100537963XP_003199443.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23517at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.