DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and Pla1a

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:397 Identity:119/397 - (29%)
Similarity:174/397 - (43%) Gaps:77/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 W--LLWTCLLLLGAAGTDASVDYFAYAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKL-LRY 73
            |  |||   |.:|.:|.         .|...:...:|.      ..|.::.|      |.| :::
  Rat    13 WGSLLW---LSIGRSGN---------VPPTTQPKCTDF------QSANLLRG------TNLKVQF 53

  Fly    74 DLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGW--AGKSVTCSNAAIKDAYLSRGNYN 136
            .|:||.:|...||:.  :.:.:|||.||.....::.|||:  .|...:..|..|: |.|...:.|
  Rat    54 LLFTPSDPGCGQLVE--EDSDIRNSEFNASLGTKLIIHGFRALGTKPSWINKFIR-ALLRAADAN 115

  Fly   137 VIILDWSRQSLDISYPRVSKQLPSIAANVAKM----LRFLHD--NTGVPYEQIYMIGHSAGSHIS 195
            ||.:||...|..:.:        |...||.|:    .|||..  ..||....|::||.|.|:|:.
  Rat   116 VIAVDWVYGSTGMYF--------SAVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVG 172

  Fly   196 GLTGKLLRPHRLGAIFALDPAG--LTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHAS 258
            |:.|...: .:||.|..|||||  .|:.||  |||||..|||:||:||||...|| ....:.|..
  Rat   173 GMVGHFYK-GQLGRITGLDPAGPEYTRASL--EERLDSGDALFVEAIHTDTDNLG-IRIPVGHVD 233

  Fly   259 FFANWGLGQPHCPNATATEFDF-VCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATC----- 317
            :|.|.|..||.||......:.: :|||..|:..:..::.......|..|:|.|:.|:..|     
  Rat   234 YFVNGGQDQPGCPAFIHAGYSYLICDHMRAVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFN 298

  Fly   318 ----NC-NVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYGTSDGLVHI----KRPR 373
                :| .:|..|:..|..         || :||....||.|...:||.....||..    ||.:
  Rat   299 PFLLSCPRIGLVERGGVKI---------EP-LPKEVRVYLQTTSSAPYCVHHSLVEFNLKEKRKK 353

  Fly   374 PSTIRET 380
            .::|..|
  Rat   354 DTSIEVT 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 102/328 (31%)
Pancreat_lipase_like 72..356 CDD:238363 98/304 (32%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 110/370 (30%)
Pancreat_lipase_like 49..332 CDD:238363 99/307 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.