DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and PNLIP

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:384 Identity:106/384 - (27%)
Similarity:153/384 - (39%) Gaps:72/384 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWTCLLLLGA-AGTDASVDYFAYAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKLLRYDLYT 77
            |||..||||| ||.:.     .|....| .|......|:......::...|:...|:.|   |||
Human     4 LWTLSLLLGAVAGKEV-----CYERLGC-FSDDSPWSGITERPLHILPWSPKDVNTRFL---LYT 59

  Fly    78 PLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGK------SVTCSNAAIKDAYLSRGNYN 136
            ..||...|.: ..|.:.:..|:|......|..|||:..|      :..|.|      .....:.|
Human    60 NENPNNFQEV-AADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKN------LFKVESVN 117

  Fly   137 VIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKL 201
            .|.:||...| ...|.:.|:.:..:.|.||..:.||....|.....:::||||.|:|.:|..|:.
Human   118 CICVDWKGGS-RTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRR 181

  Fly   202 LRPHRLGAIFALDPA-----GLTQLSLGPEERLDVNDALYVESIHTDLTLLGNP---------ST 252
            .. ..:|.|..||||     |..:|     .|||.:||.:|:.||||    |.|         |.
Human   182 TN-GTIGRITGLDPAEPCFQGTPEL-----VRLDPSDAKFVDVIHTD----GAPIVPNLGFGMSQ 236

  Fly   253 KLSHASFFANWGLGQPHCPNATATEF-----------DF-VCDHFAAMFYFAESVRQPKSFAALR 305
            .:.|..||.|.|:..|.|.....::.           || .|:|..:..|:.:|:..|..||...
Human   237 VVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFP 301

  Fly   306 CSSAKSVLSATC-NCNVGGSEK---YAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY 360
            |:|.....:..| .|..||..:   ||      :.:.|....|.::  |||.|...|.:
Human   302 CASYNVFTANKCFPCPSGGCPQMGHYA------DRYPGKTNDVGQK--FYLDTGDASNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 92/342 (27%)
Pancreat_lipase_like 72..356 CDD:238363 88/319 (28%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 96/369 (26%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.