DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and lipia

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:258 Identity:90/258 - (34%)
Similarity:129/258 - (50%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHG---------WAGKSVTCSNAAIK 126
            :|..|||..:|...|||...:  ...||.||........|||         |..:.|        
Zfish    45 VRLLLYTRADPSCGQLLSHQE--PFSNSQFNVSSVTTFLIHGYRPTGSPPVWMKQFV-------- 99

  Fly   127 DAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAG 191
            :..|:|.:.|||::||:|.:.:::|.:|.|....:|.|:..:::.:.|| |.....|:|||.|.|
Zfish   100 EFLLNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDN-GANLSSIHMIGVSLG 163

  Fly   192 SHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSH 256
            :||||.||.... ..:|.|.||||||.......||:|||.:|||:||::|||:..||..:. |.|
Zfish   164 AHISGFTGANFN-GEIGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNL-LGH 226

  Fly   257 ASFFANWGLGQPHCPNA--TATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATC 317
            ..::||.|..||.||..  :.:|: |.|||..::|.:..||.......|..|.|.......||
Zfish   227 IDYYANGGADQPGCPKTILSGSEY-FKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 90/258 (35%)
Pancreat_lipase_like 72..356 CDD:238363 90/257 (35%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 90/258 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.