DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG6271

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:295 Identity:96/295 - (32%)
Similarity:149/295 - (50%) Gaps:28/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNY 135
            :.:.|:||.||...:.:. .....:..|:|||..|.|..||||....:...|:.|:.|:||:|:|
  Fly    68 VNFYLFTPKNPSSSKHIY-ATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKGDY 131

  Fly   136 NVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGK 200
            |||::||:| :..:.|......:.:....||||:.||.||.|:....:|:||||.|:|::|..||
  Fly   132 NVIVVDWAR-ARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGK 195

  Fly   201 LLRPHRLGAIFALDPAGLTQLSLG-PEERLDVNDALYVESIHTDLTLLG--NPSTKLSHASFFAN 262
             ....::..|..|||| |...|.. |.:||:.:||.|||||.|:...||  .|   :...:|:.|
  Fly   196 -NTDGQVHTIIGLDPA-LPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKP---IGKGAFYPN 255

  Fly   263 WGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKY 327
            .|..||.||    .:....|.|..:..|:||:|.: .:|..::|...:..::..|     ||...
  Fly   256 GGKTQPGCP----LDVTGACSHGRSTTYYAEAVSE-DNFGTMKCGDYEEAVAKEC-----GSTYS 310

  Fly   328 AVNTCTGNEFMGGEP-AVPKRGIFYLSTRPQSPYG 361
            :|.       ||.:. |....|.||:....::|:|
  Fly   311 SVR-------MGADTNAYMVEGDFYVPVNSKAPFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 94/292 (32%)
Pancreat_lipase_like 72..356 CDD:238363 94/287 (33%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 94/292 (32%)
Pancreat_lipase_like 68..333 CDD:238363 94/288 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.