DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG6277

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:334 Identity:106/334 - (31%)
Similarity:159/334 - (47%) Gaps:34/334 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YAP---GKCEVSISDVIQGMITTEAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLR 96
            |.|   |..|....||.:..:  ||..:| ..|...|..:::.|||..||.:.:.: ......:.
  Fly    32 YVPQEDGTSEWVDMDVAEQWM--EAQELL-ESRGLTTVPVKFYLYTSSNPTKGKKI-TASTKSID 92

  Fly    97 NSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSI 161
            .|.||...|.|..||||........|..|:.|:||||:||||::||:| :..:.|......:.:.
  Fly    93 ASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDYNVIVVDWAR-ARSVDYATSVLAVAAT 156

  Fly   162 AANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLG-P 225
            ...||||:.||.||.|:....:|:||||.|:|::|..|| ....::..|..|||| |...|.. |
  Fly   157 GKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGK-NTDGQVHTIIGLDPA-LPLFSYNKP 219

  Fly   226 EERLDVNDALYVESIHTDLTLLG--NPSTKLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAM 288
            .:||:.:||.|||||.|:...||  .|   :...:|:.|.|..||.|    ..:....|.|..:.
  Fly   220 NKRLNSDDAWYVESIQTNGGTLGFLKP---IGKGAFYPNGGKTQPGC----GLDLTGACSHGRST 277

  Fly   289 FYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEP-AVPKRGIFYL 352
            .|:||:|.: .:|..::|...:..:|..|     ||...:|.       ||.:. |....|.:|:
  Fly   278 TYYAEAVSE-DNFGTMKCGDYEEAVSKEC-----GSTYSSVR-------MGADTNAYMVEGDYYV 329

  Fly   353 STRPQSPYG 361
            ....::|:|
  Fly   330 PVNSKAPFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 98/310 (32%)
Pancreat_lipase_like 72..356 CDD:238363 93/287 (32%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 93/288 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.