DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG17191

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:335 Identity:101/335 - (30%)
Similarity:159/335 - (47%) Gaps:38/335 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKL--LRYDLYTPLNPEERQLLRPGDLTMLRN 97
            |.|     .|....:.|...:|..:|.|....:|:.  :.:.|||..||...:.:| .|.:.:.:
  Fly    30 YVP-----QIDGSFEWMDKQDAEELLNRNSLIETRSNDVSFYLYTKHNPTVGKEIR-ADASSIED 88

  Fly    98 SHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSR-QSLDISYPRVSKQLPSI 161
            |||:.....|..||||.|:.....|..|..|:||:|:||||:::|.| ||:|  |....:.:|..
  Fly    89 SHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGDYNVIVVNWDRAQSVD--YISSVRAVPGA 151

  Fly   162 AANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPE 226
            .|.|.:|:.:||::..:..|.:.:||||.|:|::|..||.:...|:..|..||||........|:
  Fly   152 GAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPD 216

  Fly   227 ERLDVNDALYVESIHTDLTLLGNPSTK-----LSHASFFANWGLGQPHCPNATATEFDFVCDHFA 286
            :||...||.|||||.|      |...|     :...:|:.|.|..||.|    .::....|.|..
  Fly   217 KRLSTEDAFYVESIQT------NGGEKGFLKPIGKGTFYPNGGRNQPGC----GSDIGGTCAHGR 271

  Fly   287 AMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFY 351
            ::.|:.|:|.: .:|..::|...::.|:..|.....|....||.    |.:|       ..|.||
  Fly   272 SVTYYVEAVTE-DNFGTIKCHDYQAALANECGSTYSGVRMGAVT----NAYM-------VDGDFY 324

  Fly   352 LSTRPQSPYG 361
            :....|:|:|
  Fly   325 VPVNGQAPFG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 95/314 (30%)
Pancreat_lipase_like 72..356 CDD:238363 90/289 (31%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 90/290 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.