DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG6295

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:291 Identity:93/291 - (31%)
Similarity:141/291 - (48%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVII 139
            |||..|....|.::....: :..|||||..|.|.:||||:.......|..::||:.:.|:.|:|.
  Fly    68 LYTNSNRNSPQEIKATSAS-ISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIA 131

  Fly   140 LDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRP 204
            :||.| :..:.|......:|.:...||.::.|:..|.|:..:...:||||.|:|:||..||.::.
  Fly   132 VDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKN 195

  Fly   205 HRLGAIFALDPAGLTQLSL-GPEERLDVNDALYVESIHTDLTLLG--NPSTKLSHASFFANWGLG 266
            .:|..|..|||| |...|. .|.:||...||.|||||.|:...||  .|   :...:|:.|.|..
  Fly   196 GQLHTIIGLDPA-LPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKP---IGKGAFYPNGGKS 256

  Fly   267 QPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNT 331
            ||.|    ..:....|.|..::.|:||||.: .:|..:||...:..::..|     ||...:|..
  Fly   257 QPGC----GVDLTGSCAHSRSVIYYAESVTE-NNFPTMRCGDYEEAVAKEC-----GSSYSSVRM 311

  Fly   332 -CTGNEFMGGEPAVPKRGIFYLSTRPQSPYG 361
             .|.|.:|       ..|.:|:..|..:|||
  Fly   312 GATTNAYM-------VAGDYYVPVRSDAPYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 90/288 (31%)
Pancreat_lipase_like 72..356 CDD:238363 89/284 (31%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 89/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.