DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and LPL

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:341 Identity:82/341 - (24%)
Similarity:138/341 - (40%) Gaps:45/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IQGMITTEAGVILGRPRPSQTKL-LRYDLYTPLN-PEERQLLRPGDLTMLRNSHFNPKWPVRVSI 110
            :|.:..:..||.....|.....: .::.|.||.: .|:...|.||....:...|||......:.|
Human    15 LQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVI 79

  Fly   111 HGW--AGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLH 173
            |||  .|...:.....:...|....:.|||::||..::.: .||..:.....:..:||:.:.::.
Human    80 HGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQE-HYPVSAGYTKLVGQDVARFINWME 143

  Fly   174 DNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVE 238
            :....|.:.::::|:|.|:|.:|:.|.|.. .::..|..|||||..........||..:||.:|:
Human   144 EEFNYPLDNVHLLGYSLGAHAAGIAGSLTN-KKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVD 207

  Fly   239 SIHTDLTLLGNPSTKL------SHASFFANWGLGQPHCPNATAT---------EFDFV--CDHFA 286
            .:||  ...|:|...:      .|...:.|.|..||.|....|.         :.|.:  |.|..
Human   208 VLHT--FTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHER 270

  Fly   287 AMFYFAES-VRQPKSFAALRCSSAKSVLSATC------NCNVGGSEKYAVNTCTGNEFMGGEPAV 344
            ::..|.:| :.:.....|.||||.::.....|      .||..|   |.:|          :...
Human   271 SIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLG---YEIN----------KVRA 322

  Fly   345 PKRGIFYLSTRPQSPY 360
            .:....||.||.|.||
Human   323 KRSSKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 79/334 (24%)
Pancreat_lipase_like 72..356 CDD:238363 74/310 (24%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53 4/20 (20%)
Lipase 33..473 CDD:332983 78/323 (24%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 3/22 (14%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.