DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sxe2 and CG13562

DIOPT Version :9

Sequence 1:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:315 Identity:65/315 - (20%)
Similarity:118/315 - (37%) Gaps:62/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLWTCLLLLGAAGTDASVDYFAYAPGKCEVSISDVIQGMITTEAGVILGRPRPSQTKLLRYD--- 74
            |:..|:||:....:..::.|          :|....|....|:...:..:.|      ::||   
  Fly    11 LIVCCVLLIDGTHSKLNLKY----------AILRQKQAAKATQNDTLAHQQR------IKYDAQK 59

  Fly    75 ----LYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSN----AAIKDAYLS 131
                ::...|.:..:.....|...|..|..:|.....:.:|||.   .:||:    :.|:.....
  Fly    60 TMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWI---QSCSDEWALSLIERLSYY 121

  Fly   132 RGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISG 196
            ||.. ||.:|:|..: ..||.|:.....::...::.::..|. ..|...::.||.|.|.|..::.
  Fly   122 RGGC-VICIDYSVVA-SSSYMRLYTNFDTLTGAISSIILTLF-RQGFDPKRGYMFGFSFGGQLAS 183

  Fly   197 LTGKLLRPHRL----------GAIFALDPAGLTQLSLGPEERL---DVNDALYVESIHTDLTLLG 248
            ..|:.||||.:          |..|  ||..:.....|...:.   ..:...:|.|.|.:: :||
  Fly   184 AVGRSLRPHHIIESIDTCDMAGPGF--DPIAVDHSKAGKHVQCFHSSRDKGTFVYSCHRNI-MLG 245

  Fly   249 NPSTKLSHASFFANWGLGQPH--CPNATATEFDFVCDHFAAMFYFAESVRQPKSF 301
              |..|...|..:...||. |  |.:.....||:.        ::|.:...|:.|
  Fly   246 --SCGLKQPSVASQLHLGS-HGLCVDIYINTFDYP--------FYAVNYTPPECF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 58/275 (21%)
Pancreat_lipase_like 72..356 CDD:238363 56/256 (22%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.